Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ZID6

Protein Details
Accession A0A165ZID6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86QGECRSKRRTVDFKFVNRKCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MHPRRSTRSNLLYLGRSVFRLRFEADPSKLENEETTPRRTLAGILFYGHGFTLTLTGKDCKGREGEQGECRSKRRTVDFKFVNRKCPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.35
3 0.3
4 0.27
5 0.24
6 0.22
7 0.22
8 0.23
9 0.22
10 0.26
11 0.31
12 0.31
13 0.31
14 0.31
15 0.32
16 0.29
17 0.27
18 0.22
19 0.19
20 0.24
21 0.25
22 0.26
23 0.24
24 0.24
25 0.24
26 0.24
27 0.22
28 0.15
29 0.15
30 0.12
31 0.12
32 0.12
33 0.11
34 0.11
35 0.09
36 0.08
37 0.05
38 0.04
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.12
45 0.16
46 0.17
47 0.16
48 0.19
49 0.21
50 0.26
51 0.29
52 0.34
53 0.37
54 0.45
55 0.5
56 0.5
57 0.51
58 0.49
59 0.49
60 0.5
61 0.52
62 0.55
63 0.55
64 0.62
65 0.68
66 0.74
67 0.81
68 0.78