Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166GRS0

Protein Details
Accession A0A166GRS0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-69TRVRRRGTACDHCKKRKRKCVTLNDAQVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 8.5, cyto_mito 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPKDLSKVTVKKEEAFSGVLASFTVQNAQNDAVERNGKEATRVRRRGTACDHCKKRKRKCVTLNDAQVDCRLCLHAGLECTYNNYFVIRGRRALDHARGGFVQWGVVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.31
4 0.24
5 0.22
6 0.17
7 0.13
8 0.11
9 0.09
10 0.08
11 0.11
12 0.11
13 0.11
14 0.13
15 0.14
16 0.14
17 0.14
18 0.15
19 0.15
20 0.16
21 0.16
22 0.16
23 0.17
24 0.16
25 0.19
26 0.24
27 0.31
28 0.39
29 0.44
30 0.44
31 0.5
32 0.52
33 0.53
34 0.56
35 0.57
36 0.55
37 0.6
38 0.66
39 0.69
40 0.76
41 0.8
42 0.82
43 0.82
44 0.82
45 0.82
46 0.84
47 0.85
48 0.85
49 0.84
50 0.81
51 0.75
52 0.66
53 0.56
54 0.48
55 0.38
56 0.29
57 0.2
58 0.14
59 0.1
60 0.09
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.15
68 0.15
69 0.16
70 0.14
71 0.13
72 0.12
73 0.16
74 0.24
75 0.23
76 0.26
77 0.27
78 0.3
79 0.34
80 0.4
81 0.41
82 0.42
83 0.4
84 0.4
85 0.38
86 0.36
87 0.34
88 0.28