Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166BNC8

Protein Details
Accession A0A166BNC8   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-37LRTFTRPKPKANYDKSKTPRQKDLRSQPITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MTTTKGILRTFTRPKPKANYDKSKTPRQKDLRSQPITNFFKKKKKSTLSVNAGCSKKTQATTIAASSLRKRKPTVLSPTPVDLTLSSDEDEPTPDDITPEEMTSIPCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.75
4 0.77
5 0.78
6 0.8
7 0.75
8 0.82
9 0.81
10 0.82
11 0.82
12 0.77
13 0.77
14 0.76
15 0.79
16 0.79
17 0.83
18 0.83
19 0.79
20 0.75
21 0.69
22 0.7
23 0.65
24 0.61
25 0.59
26 0.55
27 0.58
28 0.62
29 0.65
30 0.64
31 0.65
32 0.66
33 0.67
34 0.71
35 0.71
36 0.69
37 0.66
38 0.63
39 0.57
40 0.5
41 0.41
42 0.33
43 0.26
44 0.22
45 0.19
46 0.16
47 0.18
48 0.2
49 0.19
50 0.2
51 0.18
52 0.19
53 0.23
54 0.28
55 0.28
56 0.3
57 0.31
58 0.36
59 0.42
60 0.49
61 0.53
62 0.53
63 0.54
64 0.53
65 0.55
66 0.49
67 0.42
68 0.34
69 0.25
70 0.21
71 0.18
72 0.17
73 0.14
74 0.14
75 0.14
76 0.14
77 0.15
78 0.14
79 0.13
80 0.13
81 0.12
82 0.12
83 0.12
84 0.16
85 0.16
86 0.15
87 0.14
88 0.14