Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165YDF8

Protein Details
Accession A0A165YDF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-40ICCSGTWRRLRRRAWTKVRMTFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 2, golg 2, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLETTGAPEASSRMWLRWICCSGTWRRLRRRAWTKVRMTFSTASRGIWIWILTWTWTWICMEIAVLLAATCFFEFSLTDPPPFTAREILTEWKTQDLKFRADFVVTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.31
5 0.33
6 0.3
7 0.31
8 0.35
9 0.36
10 0.44
11 0.51
12 0.53
13 0.6
14 0.67
15 0.7
16 0.76
17 0.79
18 0.8
19 0.81
20 0.82
21 0.8
22 0.79
23 0.8
24 0.7
25 0.64
26 0.57
27 0.48
28 0.45
29 0.36
30 0.28
31 0.24
32 0.22
33 0.18
34 0.15
35 0.13
36 0.07
37 0.08
38 0.08
39 0.07
40 0.07
41 0.08
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.07
63 0.14
64 0.15
65 0.16
66 0.16
67 0.18
68 0.19
69 0.2
70 0.2
71 0.17
72 0.16
73 0.19
74 0.22
75 0.26
76 0.28
77 0.3
78 0.29
79 0.32
80 0.33
81 0.3
82 0.37
83 0.35
84 0.38
85 0.37
86 0.39
87 0.34
88 0.34