Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4U2E0

Protein Details
Accession J4U2E0   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MAATKEPKQPKQTKEPKKRTTRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
7-32PKQPKQTKEPKKRTTRRKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAATKEPKQPKQTKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGEKWKALTAEDKQPYESKAQADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.88
4 0.91
5 0.93
6 0.93
7 0.94
8 0.94
9 0.94
10 0.94
11 0.94
12 0.93
13 0.94
14 0.94
15 0.93
16 0.86
17 0.77
18 0.69
19 0.61
20 0.54
21 0.44
22 0.35
23 0.28
24 0.25
25 0.23
26 0.19
27 0.18
28 0.16
29 0.15
30 0.13
31 0.11
32 0.1
33 0.1
34 0.12
35 0.15
36 0.16
37 0.17
38 0.19
39 0.19
40 0.2
41 0.19
42 0.19
43 0.15
44 0.12
45 0.12
46 0.1
47 0.1
48 0.09
49 0.1
50 0.08
51 0.1
52 0.12
53 0.11
54 0.11
55 0.13
56 0.12
57 0.12
58 0.18
59 0.2
60 0.27
61 0.32
62 0.32
63 0.33
64 0.34
65 0.35
66 0.33
67 0.32
68 0.27
69 0.32
70 0.41
71 0.46
72 0.52
73 0.57
74 0.6
75 0.67
76 0.66
77 0.64
78 0.61
79 0.59
80 0.59
81 0.55
82 0.54