Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166F239

Protein Details
Accession A0A166F239    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
254-284REAIPRRKQFFAKRRSQKHRDERQGMRRNEWBasic
NLS Segment(s)
PositionSequence
259-273RRKQFFAKRRSQKHR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
Amino Acid Sequences MASEVRGNETRKYATSDIMPNLRCERELGPTIGVSKAKFQLTRKAIKLKSITNVKNDWTKDADNRKENHSNPEIGKPKLIVLQHLLGEAVRKKRYFEYANVIGIVVFHESHCLTRQNDVGSELQMNSAIWDPGVRGGFSEAEESDEPAASCEEDDEDGGPVNDGVDSDPGFISGGTRINLGTGTLVVYFLPRVELPTEFNDPVDSLDDDRATALGFNSEEREGRRASESVEPFKERMPKLPEAVTPEWITVEIREAIPRRKQFFAKRRSQKHRDERQGMRRNEWTKTEIAALAPDLVEPLTLEAELEVVTGVDQPDLNTEPAEADEGQNRPASPRHLLRNKTAVCVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.4
4 0.41
5 0.46
6 0.45
7 0.42
8 0.46
9 0.44
10 0.38
11 0.35
12 0.31
13 0.3
14 0.33
15 0.31
16 0.28
17 0.27
18 0.28
19 0.29
20 0.29
21 0.23
22 0.24
23 0.26
24 0.29
25 0.33
26 0.35
27 0.42
28 0.47
29 0.55
30 0.56
31 0.61
32 0.58
33 0.61
34 0.64
35 0.59
36 0.6
37 0.62
38 0.6
39 0.56
40 0.58
41 0.54
42 0.55
43 0.51
44 0.46
45 0.41
46 0.4
47 0.43
48 0.5
49 0.55
50 0.55
51 0.56
52 0.6
53 0.64
54 0.62
55 0.62
56 0.56
57 0.53
58 0.48
59 0.55
60 0.53
61 0.45
62 0.44
63 0.36
64 0.34
65 0.33
66 0.31
67 0.23
68 0.22
69 0.24
70 0.22
71 0.21
72 0.2
73 0.15
74 0.19
75 0.21
76 0.24
77 0.26
78 0.26
79 0.29
80 0.32
81 0.39
82 0.39
83 0.39
84 0.41
85 0.4
86 0.41
87 0.38
88 0.35
89 0.27
90 0.23
91 0.19
92 0.11
93 0.07
94 0.05
95 0.07
96 0.07
97 0.09
98 0.11
99 0.15
100 0.15
101 0.18
102 0.21
103 0.2
104 0.21
105 0.22
106 0.2
107 0.17
108 0.18
109 0.15
110 0.12
111 0.11
112 0.1
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.06
119 0.09
120 0.09
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.11
127 0.08
128 0.11
129 0.11
130 0.11
131 0.1
132 0.1
133 0.09
134 0.09
135 0.09
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.03
151 0.04
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.07
162 0.06
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.04
179 0.06
180 0.07
181 0.08
182 0.1
183 0.13
184 0.17
185 0.16
186 0.16
187 0.15
188 0.14
189 0.14
190 0.14
191 0.11
192 0.08
193 0.09
194 0.09
195 0.09
196 0.09
197 0.08
198 0.06
199 0.06
200 0.05
201 0.05
202 0.06
203 0.06
204 0.08
205 0.09
206 0.1
207 0.11
208 0.14
209 0.13
210 0.14
211 0.17
212 0.15
213 0.17
214 0.24
215 0.26
216 0.29
217 0.32
218 0.32
219 0.31
220 0.34
221 0.39
222 0.32
223 0.36
224 0.37
225 0.36
226 0.37
227 0.4
228 0.38
229 0.38
230 0.39
231 0.35
232 0.29
233 0.26
234 0.23
235 0.21
236 0.19
237 0.11
238 0.12
239 0.1
240 0.1
241 0.15
242 0.18
243 0.24
244 0.32
245 0.38
246 0.4
247 0.44
248 0.51
249 0.57
250 0.63
251 0.67
252 0.7
253 0.74
254 0.81
255 0.86
256 0.88
257 0.88
258 0.89
259 0.9
260 0.9
261 0.89
262 0.88
263 0.89
264 0.89
265 0.82
266 0.77
267 0.75
268 0.68
269 0.63
270 0.57
271 0.49
272 0.41
273 0.39
274 0.35
275 0.27
276 0.24
277 0.2
278 0.17
279 0.14
280 0.12
281 0.1
282 0.08
283 0.07
284 0.07
285 0.06
286 0.06
287 0.06
288 0.06
289 0.06
290 0.05
291 0.06
292 0.06
293 0.06
294 0.04
295 0.04
296 0.04
297 0.06
298 0.06
299 0.07
300 0.07
301 0.07
302 0.11
303 0.13
304 0.14
305 0.13
306 0.13
307 0.13
308 0.13
309 0.16
310 0.13
311 0.13
312 0.17
313 0.19
314 0.21
315 0.22
316 0.22
317 0.22
318 0.26
319 0.29
320 0.32
321 0.38
322 0.47
323 0.54
324 0.59
325 0.63
326 0.69
327 0.67