Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166IVQ2

Protein Details
Accession A0A166IVQ2   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-31LPSPRQSLPSSNKRRRSPSGSPSPVHydrophilic
NLS Segment(s)
PositionSequence
20-22RRR
Subcellular Location(s) nucl 23.5, mito_nucl 13.666, cyto_nucl 13.333
Family & Domain DBs
Amino Acid Sequences MHMQIDLPSPRQSLPSSNKRRRSPSGSPSPVERDRHRPTKRITIDPCAHTLAADHEYYDQKKADPRRGSAEDWVSRTSGLHLNSPNPPPDVDVTRSADVNSVRMHETMTSQHQDTHMQSPNRRLLPPLITSLPPSPPPSHRLTRQRSHLQEPNPLPPNNFTSIRHENSTLAVPTLHLQTDHLMPPHPNTLRAPHLNIIPATPSPVTPHPGSAFTMASPMSISSPSGSWSAQSPLSPNSKKPRVTMGPRADCPKCKMGTPGHWMHYNYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.47
3 0.55
4 0.63
5 0.72
6 0.77
7 0.83
8 0.83
9 0.82
10 0.81
11 0.8
12 0.81
13 0.79
14 0.73
15 0.7
16 0.69
17 0.67
18 0.64
19 0.59
20 0.58
21 0.6
22 0.68
23 0.69
24 0.69
25 0.68
26 0.72
27 0.74
28 0.74
29 0.7
30 0.69
31 0.7
32 0.65
33 0.61
34 0.53
35 0.46
36 0.36
37 0.31
38 0.24
39 0.2
40 0.17
41 0.15
42 0.15
43 0.2
44 0.21
45 0.24
46 0.21
47 0.2
48 0.27
49 0.34
50 0.41
51 0.42
52 0.44
53 0.49
54 0.52
55 0.53
56 0.52
57 0.53
58 0.47
59 0.44
60 0.42
61 0.33
62 0.29
63 0.27
64 0.24
65 0.2
66 0.17
67 0.19
68 0.2
69 0.23
70 0.28
71 0.3
72 0.29
73 0.26
74 0.24
75 0.21
76 0.22
77 0.23
78 0.21
79 0.23
80 0.25
81 0.24
82 0.24
83 0.23
84 0.23
85 0.2
86 0.19
87 0.15
88 0.13
89 0.13
90 0.13
91 0.13
92 0.11
93 0.12
94 0.13
95 0.16
96 0.17
97 0.16
98 0.17
99 0.18
100 0.2
101 0.21
102 0.24
103 0.26
104 0.28
105 0.29
106 0.35
107 0.4
108 0.39
109 0.37
110 0.32
111 0.29
112 0.29
113 0.29
114 0.25
115 0.21
116 0.19
117 0.21
118 0.21
119 0.19
120 0.17
121 0.18
122 0.18
123 0.18
124 0.22
125 0.26
126 0.29
127 0.35
128 0.43
129 0.48
130 0.52
131 0.57
132 0.62
133 0.61
134 0.63
135 0.61
136 0.54
137 0.55
138 0.51
139 0.51
140 0.48
141 0.45
142 0.39
143 0.35
144 0.36
145 0.32
146 0.31
147 0.25
148 0.27
149 0.33
150 0.35
151 0.34
152 0.32
153 0.28
154 0.28
155 0.28
156 0.2
157 0.14
158 0.12
159 0.1
160 0.11
161 0.11
162 0.1
163 0.08
164 0.08
165 0.09
166 0.12
167 0.13
168 0.13
169 0.13
170 0.14
171 0.16
172 0.23
173 0.22
174 0.22
175 0.22
176 0.26
177 0.32
178 0.34
179 0.35
180 0.3
181 0.3
182 0.31
183 0.29
184 0.25
185 0.2
186 0.17
187 0.17
188 0.15
189 0.13
190 0.15
191 0.17
192 0.21
193 0.19
194 0.23
195 0.22
196 0.23
197 0.24
198 0.22
199 0.2
200 0.16
201 0.17
202 0.14
203 0.12
204 0.11
205 0.1
206 0.09
207 0.09
208 0.09
209 0.08
210 0.09
211 0.11
212 0.12
213 0.12
214 0.11
215 0.13
216 0.15
217 0.16
218 0.16
219 0.18
220 0.21
221 0.31
222 0.33
223 0.39
224 0.46
225 0.53
226 0.55
227 0.55
228 0.6
229 0.6
230 0.66
231 0.69
232 0.69
233 0.7
234 0.72
235 0.77
236 0.72
237 0.68
238 0.66
239 0.63
240 0.54
241 0.48
242 0.5
243 0.51
244 0.54
245 0.57
246 0.59
247 0.56
248 0.6