Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165VKZ4

Protein Details
Accession A0A165VKZ4   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
202-227AVGHSHRSRSRSPRARRSGAYDRRRSBasic
NLS Segment(s)
PositionSequence
181-229EKKAMDERHRKAGERGERKSEAVGHSHRSRSRSPRARRSGAYDRRRSRS
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019129  Folate-sensitive_fs_Fra10Ac1  
Pfam View protein in Pfam  
PF09725  Fra10Ac1  
Amino Acid Sequences MFSSSALRTNPRTEFDILKASHRFLRDDAEGSNDKQLSWEQQIAKKYYDNLYREFAVCNLKHYKSGNFALRWRTEEEVLSGAGETTCGNIRCHHHDRADNDVQLKTLEVPFSYEEAGEYKSCLVKLVLCARCTKKLMWKWEKEREKLARDEDLKGAEGGGDRMTGQEPALRAPEQGKSAVEKKAMDERHRKAGERGERKSEAVGHSHRSRSRSPRARRSGAYDRRRSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.42
4 0.37
5 0.4
6 0.39
7 0.37
8 0.38
9 0.36
10 0.35
11 0.28
12 0.33
13 0.29
14 0.29
15 0.27
16 0.29
17 0.3
18 0.28
19 0.33
20 0.27
21 0.24
22 0.23
23 0.25
24 0.23
25 0.25
26 0.3
27 0.28
28 0.33
29 0.39
30 0.41
31 0.41
32 0.38
33 0.37
34 0.38
35 0.41
36 0.39
37 0.37
38 0.37
39 0.37
40 0.35
41 0.33
42 0.28
43 0.28
44 0.25
45 0.27
46 0.3
47 0.29
48 0.32
49 0.34
50 0.34
51 0.32
52 0.38
53 0.4
54 0.37
55 0.4
56 0.43
57 0.43
58 0.42
59 0.39
60 0.34
61 0.29
62 0.26
63 0.24
64 0.18
65 0.16
66 0.13
67 0.1
68 0.08
69 0.07
70 0.06
71 0.05
72 0.05
73 0.08
74 0.09
75 0.1
76 0.13
77 0.17
78 0.25
79 0.3
80 0.34
81 0.35
82 0.39
83 0.41
84 0.46
85 0.47
86 0.4
87 0.37
88 0.32
89 0.28
90 0.24
91 0.21
92 0.14
93 0.1
94 0.09
95 0.07
96 0.08
97 0.08
98 0.09
99 0.09
100 0.08
101 0.07
102 0.08
103 0.09
104 0.08
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.11
113 0.2
114 0.23
115 0.23
116 0.28
117 0.3
118 0.34
119 0.35
120 0.34
121 0.34
122 0.37
123 0.47
124 0.51
125 0.58
126 0.62
127 0.7
128 0.76
129 0.7
130 0.73
131 0.69
132 0.64
133 0.6
134 0.55
135 0.52
136 0.46
137 0.46
138 0.39
139 0.33
140 0.28
141 0.23
142 0.2
143 0.13
144 0.11
145 0.09
146 0.08
147 0.06
148 0.06
149 0.07
150 0.08
151 0.07
152 0.07
153 0.08
154 0.09
155 0.1
156 0.13
157 0.13
158 0.13
159 0.15
160 0.18
161 0.18
162 0.19
163 0.18
164 0.2
165 0.24
166 0.27
167 0.28
168 0.25
169 0.27
170 0.33
171 0.39
172 0.42
173 0.48
174 0.49
175 0.56
176 0.59
177 0.58
178 0.55
179 0.59
180 0.61
181 0.61
182 0.62
183 0.6
184 0.59
185 0.58
186 0.55
187 0.51
188 0.43
189 0.4
190 0.39
191 0.39
192 0.43
193 0.49
194 0.51
195 0.5
196 0.56
197 0.58
198 0.65
199 0.68
200 0.72
201 0.75
202 0.81
203 0.84
204 0.8
205 0.8
206 0.8
207 0.8
208 0.8
209 0.8