Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165P2S5

Protein Details
Accession A0A165P2S5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-158ALIPPALSRPRKRPKPRDPPVPPRLAGHydrophilic
NLS Segment(s)
PositionSequence
140-155RPRKRPKPRDPPVPPR
Subcellular Location(s) nucl 14, cyto_nucl 11, cyto 6, mito 3, pero 2
Family & Domain DBs
Amino Acid Sequences MPTVPSVPVTPSSHSDIPSVPSPSASDRDAVAGPTPDPDTDDVLLAVTPCDPEGPAGRDSQPRRIPSLSNLVLHSPSSILGTPLDPTARFEYPFPSPSDGPSPSSSPDTDLPRYYYHYHSPVFPLLTAAVFALIPPALSRPRKRPKPRDPPVPPRLAGRSSQNTNISSGDEKQRRHSSPAAVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.29
4 0.3
5 0.32
6 0.31
7 0.24
8 0.23
9 0.23
10 0.25
11 0.27
12 0.24
13 0.19
14 0.17
15 0.19
16 0.19
17 0.18
18 0.16
19 0.14
20 0.13
21 0.14
22 0.15
23 0.12
24 0.14
25 0.14
26 0.15
27 0.14
28 0.14
29 0.12
30 0.11
31 0.11
32 0.1
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.1
41 0.13
42 0.14
43 0.16
44 0.19
45 0.26
46 0.29
47 0.37
48 0.39
49 0.38
50 0.41
51 0.41
52 0.4
53 0.36
54 0.42
55 0.36
56 0.31
57 0.3
58 0.27
59 0.26
60 0.24
61 0.2
62 0.11
63 0.09
64 0.08
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.07
73 0.09
74 0.12
75 0.13
76 0.13
77 0.13
78 0.15
79 0.17
80 0.19
81 0.18
82 0.17
83 0.17
84 0.18
85 0.22
86 0.2
87 0.21
88 0.2
89 0.2
90 0.18
91 0.2
92 0.19
93 0.17
94 0.2
95 0.22
96 0.22
97 0.23
98 0.23
99 0.23
100 0.27
101 0.27
102 0.26
103 0.26
104 0.28
105 0.28
106 0.27
107 0.28
108 0.27
109 0.24
110 0.21
111 0.17
112 0.13
113 0.12
114 0.11
115 0.08
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.07
124 0.14
125 0.21
126 0.26
127 0.36
128 0.47
129 0.58
130 0.7
131 0.78
132 0.83
133 0.87
134 0.92
135 0.93
136 0.92
137 0.92
138 0.9
139 0.86
140 0.76
141 0.71
142 0.66
143 0.57
144 0.51
145 0.48
146 0.47
147 0.45
148 0.5
149 0.49
150 0.45
151 0.44
152 0.42
153 0.36
154 0.31
155 0.31
156 0.35
157 0.36
158 0.38
159 0.45
160 0.53
161 0.54
162 0.57
163 0.58
164 0.55