Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165V043

Protein Details
Accession A0A165V043    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
126-154QAEAKTAKNRAKRQKKKGKAKAAKQQDSQHydrophilic
NLS Segment(s)
PositionSequence
130-149KTAKNRAKRQKKKGKAKAAK
Subcellular Location(s) nucl 14.5, mito_nucl 12.166, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MAPVASVSPSPLPNAASHSPSPGPSGGPRHAQTPLDRQRSQLEKLLKDPAKPAYIPPPPKEKIVRAPREMMKNVQGSSAGAGSGEFHVYKASRRREYERLKLMEEQTKKEVETAEFEQKKREWEQQAEAKTAKNRAKRQKKKGKAKAAKQQDSQQQEDHGMGRPRDDGSIPSAPLKKRRLVSGKQLVFRRPGEESEEEDGGESGDEAGPQPAGEENEEGIVAPVPTTEGHKINIIEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.27
4 0.27
5 0.3
6 0.3
7 0.3
8 0.31
9 0.26
10 0.25
11 0.25
12 0.31
13 0.3
14 0.36
15 0.36
16 0.36
17 0.39
18 0.39
19 0.39
20 0.43
21 0.49
22 0.5
23 0.5
24 0.49
25 0.54
26 0.56
27 0.55
28 0.51
29 0.48
30 0.43
31 0.45
32 0.53
33 0.47
34 0.43
35 0.44
36 0.42
37 0.38
38 0.35
39 0.35
40 0.34
41 0.4
42 0.45
43 0.45
44 0.49
45 0.47
46 0.52
47 0.54
48 0.5
49 0.52
50 0.57
51 0.6
52 0.55
53 0.6
54 0.6
55 0.62
56 0.59
57 0.52
58 0.48
59 0.43
60 0.4
61 0.33
62 0.28
63 0.21
64 0.19
65 0.16
66 0.1
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.13
77 0.21
78 0.28
79 0.33
80 0.37
81 0.43
82 0.52
83 0.59
84 0.63
85 0.64
86 0.59
87 0.55
88 0.55
89 0.52
90 0.49
91 0.44
92 0.38
93 0.32
94 0.3
95 0.28
96 0.25
97 0.22
98 0.16
99 0.18
100 0.18
101 0.25
102 0.28
103 0.28
104 0.3
105 0.3
106 0.32
107 0.31
108 0.35
109 0.3
110 0.3
111 0.36
112 0.39
113 0.4
114 0.39
115 0.37
116 0.32
117 0.3
118 0.34
119 0.34
120 0.36
121 0.43
122 0.51
123 0.62
124 0.7
125 0.78
126 0.82
127 0.87
128 0.91
129 0.92
130 0.93
131 0.91
132 0.9
133 0.88
134 0.88
135 0.84
136 0.76
137 0.73
138 0.69
139 0.65
140 0.58
141 0.5
142 0.4
143 0.34
144 0.32
145 0.26
146 0.24
147 0.23
148 0.21
149 0.21
150 0.21
151 0.2
152 0.2
153 0.2
154 0.15
155 0.17
156 0.2
157 0.19
158 0.23
159 0.27
160 0.29
161 0.37
162 0.4
163 0.4
164 0.4
165 0.48
166 0.52
167 0.52
168 0.6
169 0.62
170 0.64
171 0.64
172 0.66
173 0.61
174 0.58
175 0.54
176 0.46
177 0.38
178 0.34
179 0.34
180 0.32
181 0.33
182 0.32
183 0.3
184 0.27
185 0.25
186 0.23
187 0.17
188 0.14
189 0.09
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.07
196 0.06
197 0.07
198 0.09
199 0.1
200 0.11
201 0.12
202 0.12
203 0.12
204 0.13
205 0.12
206 0.1
207 0.1
208 0.08
209 0.07
210 0.06
211 0.07
212 0.08
213 0.12
214 0.16
215 0.17
216 0.19
217 0.23
218 0.24