Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UXT5

Protein Details
Accession A0A165UXT5    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28SIFYRPKDKKLHADQARQNFVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito_nucl 10.333, cyto_nucl 8.833, mito 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011709  DEAD-box_helicase_OB_fold  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF07717  OB_NTP_bind  
Amino Acid Sequences MLSESGSIFYRPKDKKLHADQARQNFVRPGGDHFTLLNVWEQWAETNYSQQFCYEQFLQFKSLSRARDIRDQLAGLCERVEIVVQSNPNSNDITPIQKAITAGYFYNTAQLQKSGDSYRTLKTSQTVYIHPSSSLFQHQPPVKTLLYYELVMTSKSYLRQVMEIKPQWLMEVASHYFKPADLEQSATGDKKMPKTIGSSGDSTRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.66
4 0.73
5 0.73
6 0.79
7 0.8
8 0.81
9 0.83
10 0.74
11 0.66
12 0.58
13 0.51
14 0.45
15 0.38
16 0.34
17 0.31
18 0.31
19 0.29
20 0.26
21 0.26
22 0.21
23 0.21
24 0.17
25 0.12
26 0.11
27 0.1
28 0.11
29 0.1
30 0.11
31 0.14
32 0.12
33 0.18
34 0.2
35 0.21
36 0.21
37 0.21
38 0.21
39 0.18
40 0.23
41 0.18
42 0.2
43 0.21
44 0.23
45 0.25
46 0.25
47 0.26
48 0.27
49 0.29
50 0.27
51 0.29
52 0.32
53 0.32
54 0.4
55 0.4
56 0.37
57 0.34
58 0.33
59 0.29
60 0.28
61 0.25
62 0.17
63 0.14
64 0.11
65 0.09
66 0.09
67 0.08
68 0.05
69 0.06
70 0.08
71 0.09
72 0.1
73 0.13
74 0.13
75 0.15
76 0.15
77 0.13
78 0.14
79 0.14
80 0.17
81 0.14
82 0.14
83 0.13
84 0.13
85 0.13
86 0.11
87 0.1
88 0.08
89 0.08
90 0.08
91 0.09
92 0.08
93 0.1
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.09
100 0.12
101 0.11
102 0.12
103 0.15
104 0.17
105 0.18
106 0.2
107 0.2
108 0.19
109 0.19
110 0.2
111 0.21
112 0.22
113 0.21
114 0.23
115 0.24
116 0.24
117 0.22
118 0.21
119 0.17
120 0.17
121 0.2
122 0.17
123 0.16
124 0.23
125 0.26
126 0.27
127 0.29
128 0.32
129 0.27
130 0.26
131 0.25
132 0.22
133 0.21
134 0.19
135 0.17
136 0.14
137 0.15
138 0.15
139 0.15
140 0.12
141 0.12
142 0.13
143 0.15
144 0.15
145 0.16
146 0.21
147 0.24
148 0.28
149 0.36
150 0.37
151 0.36
152 0.36
153 0.35
154 0.3
155 0.27
156 0.22
157 0.14
158 0.16
159 0.17
160 0.19
161 0.19
162 0.19
163 0.18
164 0.18
165 0.21
166 0.17
167 0.21
168 0.18
169 0.21
170 0.21
171 0.25
172 0.27
173 0.24
174 0.23
175 0.23
176 0.27
177 0.29
178 0.34
179 0.33
180 0.33
181 0.37
182 0.42
183 0.43
184 0.43
185 0.41