Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J6EJ78

Protein Details
Accession J6EJ78    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-81GRIHDNSPKQRRKDQSQYSSRFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 10.666, nucl 7.5, cyto_nucl 7.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013726  DUF1748_fun  
Pfam View protein in Pfam  
PF08520  DUF1748  
Amino Acid Sequences MLLSAIRRETGMIFFYNRYQLGGWIHRYMSWGEMCYSRTLKMVKRSSLFRKQLSEDGFGRIHDNSPKQRRKDQSQYSSRFVELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.22
4 0.2
5 0.19
6 0.17
7 0.18
8 0.21
9 0.24
10 0.26
11 0.24
12 0.24
13 0.23
14 0.24
15 0.22
16 0.2
17 0.16
18 0.13
19 0.13
20 0.14
21 0.15
22 0.16
23 0.17
24 0.14
25 0.16
26 0.18
27 0.21
28 0.28
29 0.32
30 0.33
31 0.35
32 0.41
33 0.46
34 0.53
35 0.55
36 0.49
37 0.48
38 0.47
39 0.5
40 0.47
41 0.43
42 0.34
43 0.33
44 0.3
45 0.26
46 0.25
47 0.2
48 0.2
49 0.21
50 0.27
51 0.33
52 0.44
53 0.52
54 0.56
55 0.65
56 0.71
57 0.75
58 0.79
59 0.8
60 0.8
61 0.82
62 0.83
63 0.79
64 0.73