Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TT89

Protein Details
Accession A0A165TT89   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-27VHIICVCPRRRPKSHLRSQIREPSGHydrophilic
NLS Segment(s)
PositionSequence
12-31RRPKSHLRSQIREPSGKHRG
Subcellular Location(s) mito 14, extr 4, cyto 3, plas 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTVHIICVCPRRRPKSHLRSQIREPSGKHRGRLRLISFCTLVAVPAPRNASSTDSSIHVCLLRILLPFAEPICILPCAAPAHPWPAETTESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.82
4 0.84
5 0.83
6 0.81
7 0.82
8 0.84
9 0.78
10 0.72
11 0.64
12 0.62
13 0.63
14 0.59
15 0.55
16 0.53
17 0.55
18 0.55
19 0.6
20 0.55
21 0.52
22 0.52
23 0.5
24 0.43
25 0.35
26 0.31
27 0.23
28 0.18
29 0.12
30 0.1
31 0.08
32 0.1
33 0.12
34 0.11
35 0.12
36 0.13
37 0.15
38 0.15
39 0.16
40 0.15
41 0.15
42 0.16
43 0.15
44 0.14
45 0.12
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.07
58 0.08
59 0.09
60 0.1
61 0.09
62 0.09
63 0.12
64 0.14
65 0.14
66 0.16
67 0.15
68 0.21
69 0.22
70 0.23
71 0.21
72 0.22