Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165UBX5

Protein Details
Accession A0A165UBX5    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-34FIPLPGQVRKRPRRRYDEIERNYHydrophilic
63-82RRTPAEFKELRKQWRKQKKEBasic
NLS Segment(s)
PositionSequence
72-82LRKQWRKQKKE
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences AGSGSNKKTYSFIPLPGQVRKRPRRRYDEIERNYVCSWPGCTKAYGTLNHLNAHVVMQGHGQRRTPAEFKELRKQWRKQKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.48
4 0.52
5 0.5
6 0.58
7 0.63
8 0.68
9 0.73
10 0.78
11 0.79
12 0.82
13 0.84
14 0.84
15 0.85
16 0.79
17 0.78
18 0.68
19 0.62
20 0.54
21 0.46
22 0.35
23 0.24
24 0.22
25 0.15
26 0.18
27 0.16
28 0.16
29 0.16
30 0.2
31 0.23
32 0.21
33 0.24
34 0.27
35 0.28
36 0.28
37 0.28
38 0.24
39 0.2
40 0.19
41 0.15
42 0.09
43 0.08
44 0.1
45 0.15
46 0.2
47 0.22
48 0.22
49 0.23
50 0.26
51 0.31
52 0.32
53 0.29
54 0.33
55 0.38
56 0.43
57 0.52
58 0.56
59 0.61
60 0.67
61 0.74
62 0.77