Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J5PGX5

Protein Details
Accession J5PGX5   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-37PSAGKNKTNNLIKQKPRNNRASGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13.166, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Pfam View protein in Pfam  
PF15365  PNRC  
Amino Acid Sequences MSTDTMYFNSSRLLPSAGKNKTNNLIKQKPRNNRASGNTAKNISNNTSTTDIPPPQTLPNGEKPNFGHSSNKKPSFYQKKHSSPSPPSSMSSPGKKNREHNKEGPRQSNRNESRLHSQNLKNLLLNQKQTPHNPRGIIPMNCNGSAKKFSHSYAGSTFATNGPREAKSLPKPSFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.33
4 0.37
5 0.43
6 0.44
7 0.48
8 0.54
9 0.6
10 0.61
11 0.61
12 0.65
13 0.68
14 0.76
15 0.8
16 0.82
17 0.83
18 0.84
19 0.8
20 0.78
21 0.74
22 0.73
23 0.71
24 0.67
25 0.62
26 0.56
27 0.51
28 0.45
29 0.42
30 0.36
31 0.31
32 0.25
33 0.24
34 0.24
35 0.24
36 0.25
37 0.27
38 0.25
39 0.24
40 0.24
41 0.23
42 0.21
43 0.23
44 0.23
45 0.22
46 0.29
47 0.35
48 0.34
49 0.36
50 0.35
51 0.39
52 0.39
53 0.36
54 0.36
55 0.33
56 0.43
57 0.48
58 0.52
59 0.47
60 0.46
61 0.56
62 0.58
63 0.59
64 0.59
65 0.59
66 0.62
67 0.65
68 0.68
69 0.65
70 0.6
71 0.61
72 0.56
73 0.47
74 0.4
75 0.38
76 0.39
77 0.35
78 0.34
79 0.36
80 0.38
81 0.43
82 0.46
83 0.53
84 0.58
85 0.63
86 0.64
87 0.66
88 0.69
89 0.72
90 0.75
91 0.75
92 0.72
93 0.69
94 0.66
95 0.68
96 0.62
97 0.57
98 0.53
99 0.47
100 0.48
101 0.49
102 0.49
103 0.45
104 0.45
105 0.45
106 0.47
107 0.45
108 0.38
109 0.36
110 0.41
111 0.38
112 0.39
113 0.36
114 0.37
115 0.4
116 0.47
117 0.5
118 0.47
119 0.47
120 0.45
121 0.44
122 0.46
123 0.49
124 0.44
125 0.41
126 0.42
127 0.41
128 0.4
129 0.4
130 0.33
131 0.29
132 0.32
133 0.29
134 0.27
135 0.26
136 0.27
137 0.33
138 0.33
139 0.33
140 0.3
141 0.34
142 0.3
143 0.28
144 0.28
145 0.24
146 0.27
147 0.23
148 0.24
149 0.23
150 0.23
151 0.25
152 0.26
153 0.32
154 0.37
155 0.46