Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4TYD5

Protein Details
Accession J4TYD5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
16-39TKNVSCYRPRREGERKRKSVRGAIHydrophilic
116-140LVTPQRLQRKRHQRALKVRNAQSQRHydrophilic
NLS Segment(s)
PositionSequence
25-34RREGERKRKS
152-174KRLSERKAEKAEIRKRRASSLKA
Subcellular Location(s) mito 12, nucl 6, cyto_nucl 6, cyto 4, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKQGVLLPTRIKLLLTKNVSCYRPRREGERKRKSVRGAIVGPDLAVLALVIIKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKEDDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQSQREAAAEYAQLLAKRLSERKAEKAEIRKRRASSLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.38
4 0.43
5 0.5
6 0.52
7 0.54
8 0.56
9 0.55
10 0.58
11 0.58
12 0.61
13 0.65
14 0.73
15 0.78
16 0.81
17 0.83
18 0.81
19 0.85
20 0.81
21 0.78
22 0.73
23 0.7
24 0.61
25 0.54
26 0.49
27 0.42
28 0.36
29 0.27
30 0.2
31 0.12
32 0.09
33 0.05
34 0.03
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.06
43 0.05
44 0.06
45 0.07
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.13
54 0.11
55 0.13
56 0.21
57 0.27
58 0.35
59 0.41
60 0.5
61 0.56
62 0.67
63 0.74
64 0.72
65 0.72
66 0.65
67 0.59
68 0.53
69 0.44
70 0.39
71 0.33
72 0.28
73 0.27
74 0.27
75 0.26
76 0.23
77 0.23
78 0.19
79 0.18
80 0.17
81 0.13
82 0.17
83 0.17
84 0.17
85 0.19
86 0.2
87 0.22
88 0.27
89 0.28
90 0.25
91 0.28
92 0.3
93 0.36
94 0.42
95 0.43
96 0.44
97 0.47
98 0.53
99 0.55
100 0.56
101 0.53
102 0.54
103 0.59
104 0.61
105 0.63
106 0.6
107 0.65
108 0.68
109 0.68
110 0.69
111 0.72
112 0.72
113 0.76
114 0.79
115 0.78
116 0.82
117 0.87
118 0.86
119 0.85
120 0.81
121 0.8
122 0.76
123 0.7
124 0.63
125 0.56
126 0.47
127 0.38
128 0.34
129 0.25
130 0.21
131 0.18
132 0.14
133 0.13
134 0.13
135 0.12
136 0.12
137 0.13
138 0.14
139 0.19
140 0.23
141 0.25
142 0.33
143 0.38
144 0.45
145 0.52
146 0.56
147 0.59
148 0.65
149 0.71
150 0.73
151 0.75
152 0.75
153 0.7
154 0.74