Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165VE68

Protein Details
Accession A0A165VE68    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-56LASYRGKQPKLKFPRSRCAGHydrophilic
NLS Segment(s)
PositionSequence
295-308RRRPAGRRRARSRL
Subcellular Location(s) nucl 11.5, cyto_nucl 8.5, plas 7, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045121  CoAse  
IPR015797  NUDIX_hydrolase-like_dom_sf  
IPR000086  NUDIX_hydrolase_dom  
Gene Ontology GO:0010945  F:CoA pyrophosphatase activity  
Pfam View protein in Pfam  
PF00293  NUDIX  
PROSITE View protein in PROSITE  
PS51462  NUDIX  
CDD cd03426  CoAse  
Amino Acid Sequences MAYKNQSDLYKFHRPRINLRETPYPLKEESKTCLRRLASYRGKQPKLKFPRSRCAGVLVALFVGRMGDLYVLLSRRSATLRSYAGDTSLPGGKVEPQDRSIEETARREAFEEIGLPIDRQKAPLLCILQPFMARDQLIVTPVVVLILDNDVRPILNTAEVTSIFSHPLAAFLSSESPFPTEPEAIELPYHSFDDVTWKWGKAKEQKIRMHRFLTGREAGGVKPVFGLTAAILIEAATIGYARDPEFDLYADNQPTQLERIVSAMKFAEHFKEAMREEGLDPDNVPDPSKFADYGRRRPAGRRRARSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.62
3 0.68
4 0.71
5 0.65
6 0.68
7 0.69
8 0.69
9 0.73
10 0.66
11 0.6
12 0.52
13 0.52
14 0.51
15 0.45
16 0.44
17 0.47
18 0.49
19 0.47
20 0.51
21 0.47
22 0.5
23 0.53
24 0.57
25 0.57
26 0.59
27 0.68
28 0.71
29 0.76
30 0.75
31 0.76
32 0.77
33 0.77
34 0.8
35 0.8
36 0.77
37 0.81
38 0.8
39 0.78
40 0.68
41 0.62
42 0.53
43 0.45
44 0.38
45 0.27
46 0.21
47 0.16
48 0.15
49 0.09
50 0.08
51 0.05
52 0.04
53 0.04
54 0.03
55 0.04
56 0.05
57 0.07
58 0.08
59 0.09
60 0.09
61 0.09
62 0.11
63 0.13
64 0.13
65 0.13
66 0.17
67 0.19
68 0.2
69 0.22
70 0.2
71 0.2
72 0.19
73 0.17
74 0.14
75 0.15
76 0.14
77 0.11
78 0.12
79 0.14
80 0.19
81 0.21
82 0.21
83 0.21
84 0.23
85 0.23
86 0.28
87 0.27
88 0.25
89 0.26
90 0.27
91 0.29
92 0.28
93 0.27
94 0.23
95 0.22
96 0.19
97 0.15
98 0.13
99 0.09
100 0.11
101 0.11
102 0.09
103 0.1
104 0.13
105 0.13
106 0.13
107 0.15
108 0.14
109 0.15
110 0.19
111 0.2
112 0.18
113 0.19
114 0.18
115 0.17
116 0.17
117 0.16
118 0.14
119 0.13
120 0.11
121 0.1
122 0.11
123 0.1
124 0.1
125 0.09
126 0.08
127 0.06
128 0.06
129 0.06
130 0.04
131 0.04
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.06
141 0.05
142 0.06
143 0.06
144 0.06
145 0.07
146 0.08
147 0.09
148 0.09
149 0.09
150 0.08
151 0.08
152 0.08
153 0.07
154 0.08
155 0.07
156 0.06
157 0.06
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.09
164 0.09
165 0.09
166 0.11
167 0.09
168 0.09
169 0.12
170 0.12
171 0.12
172 0.12
173 0.11
174 0.11
175 0.11
176 0.11
177 0.08
178 0.07
179 0.07
180 0.14
181 0.14
182 0.17
183 0.18
184 0.19
185 0.21
186 0.24
187 0.31
188 0.33
189 0.43
190 0.47
191 0.55
192 0.62
193 0.7
194 0.76
195 0.74
196 0.68
197 0.63
198 0.58
199 0.52
200 0.51
201 0.43
202 0.34
203 0.31
204 0.29
205 0.23
206 0.26
207 0.23
208 0.16
209 0.14
210 0.14
211 0.12
212 0.11
213 0.11
214 0.05
215 0.07
216 0.06
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.04
223 0.02
224 0.03
225 0.03
226 0.03
227 0.05
228 0.05
229 0.07
230 0.08
231 0.1
232 0.11
233 0.11
234 0.12
235 0.14
236 0.19
237 0.19
238 0.18
239 0.18
240 0.17
241 0.18
242 0.18
243 0.17
244 0.13
245 0.12
246 0.15
247 0.18
248 0.18
249 0.18
250 0.17
251 0.16
252 0.17
253 0.18
254 0.19
255 0.16
256 0.17
257 0.17
258 0.24
259 0.24
260 0.26
261 0.25
262 0.23
263 0.23
264 0.29
265 0.28
266 0.22
267 0.21
268 0.2
269 0.23
270 0.22
271 0.23
272 0.16
273 0.17
274 0.2
275 0.22
276 0.21
277 0.19
278 0.3
279 0.37
280 0.46
281 0.53
282 0.57
283 0.57
284 0.65
285 0.73
286 0.74
287 0.76
288 0.77