Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SWU5

Protein Details
Accession A0A165SWU5   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MNPLLTRSKRWKWHSGRRSAERKAHNPHydrophilic
NLS Segment(s)
PositionSequence
16-18GRR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNPLLTRSKRWKWHSGRRSAERKAHNPQVCQHRALDASVSYSSKKSIRVRVPPAPITGHKSTDAAPPSRKKSAHTSHRHLPSVLLIYPQRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.85
4 0.85
5 0.87
6 0.84
7 0.82
8 0.8
9 0.77
10 0.76
11 0.75
12 0.7
13 0.64
14 0.63
15 0.65
16 0.59
17 0.53
18 0.45
19 0.37
20 0.33
21 0.31
22 0.25
23 0.15
24 0.14
25 0.13
26 0.14
27 0.12
28 0.11
29 0.13
30 0.13
31 0.19
32 0.21
33 0.29
34 0.35
35 0.42
36 0.49
37 0.53
38 0.57
39 0.52
40 0.5
41 0.45
42 0.4
43 0.39
44 0.35
45 0.3
46 0.26
47 0.25
48 0.24
49 0.26
50 0.28
51 0.26
52 0.31
53 0.36
54 0.41
55 0.47
56 0.47
57 0.45
58 0.51
59 0.57
60 0.61
61 0.63
62 0.65
63 0.68
64 0.75
65 0.74
66 0.65
67 0.56
68 0.5
69 0.45
70 0.38
71 0.34