Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PAA5

Protein Details
Accession A0A165PAA5    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTNHNQSKKAHRNGIKKPKTNRTRSLKHydrophilic
NLS Segment(s)
PositionSequence
14-40KKAHRNGIKKPKTNRTRSLKGVDAKFR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQSKKAHRNGIKKPKTNRTRSLKGVDAKFRRNARYALIGSYKARAEADASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.76
5 0.76
6 0.78
7 0.84
8 0.83
9 0.81
10 0.81
11 0.82
12 0.83
13 0.82
14 0.8
15 0.78
16 0.75
17 0.72
18 0.68
19 0.64
20 0.6
21 0.57
22 0.57
23 0.53
24 0.51
25 0.54
26 0.54
27 0.51
28 0.48
29 0.45
30 0.39
31 0.41
32 0.38
33 0.36
34 0.34
35 0.34
36 0.32
37 0.34
38 0.3
39 0.24
40 0.23
41 0.19