Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165UDT9

Protein Details
Accession A0A165UDT9    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKLLMCRRGPRRCRLQHHYVRRVCRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKLLMCRRGPRRCRLQHHYVRRVCRPLIPVICQFFSRGGDRWRETLRTKYGYINLLVDNCGIFLRDADLPIVFRPGETKCGGKQLLSANFDTPHFYFYDKGYVEEIKNAESLGYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.84
4 0.88
5 0.88
6 0.84
7 0.82
8 0.8
9 0.77
10 0.68
11 0.62
12 0.55
13 0.53
14 0.5
15 0.47
16 0.45
17 0.42
18 0.41
19 0.37
20 0.34
21 0.27
22 0.25
23 0.23
24 0.21
25 0.21
26 0.27
27 0.28
28 0.31
29 0.32
30 0.34
31 0.34
32 0.37
33 0.39
34 0.36
35 0.36
36 0.34
37 0.35
38 0.32
39 0.3
40 0.25
41 0.2
42 0.16
43 0.15
44 0.12
45 0.09
46 0.07
47 0.06
48 0.05
49 0.04
50 0.04
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.1
59 0.07
60 0.07
61 0.09
62 0.1
63 0.14
64 0.15
65 0.17
66 0.16
67 0.23
68 0.24
69 0.22
70 0.24
71 0.28
72 0.33
73 0.33
74 0.33
75 0.29
76 0.29
77 0.3
78 0.3
79 0.22
80 0.17
81 0.15
82 0.16
83 0.15
84 0.16
85 0.23
86 0.2
87 0.21
88 0.23
89 0.26
90 0.25
91 0.29
92 0.29
93 0.22
94 0.22
95 0.2