Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165N0X5

Protein Details
Accession A0A165N0X5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
29-51HPYPSIKSSRRRRRDVRPKLYVHBasic
NLS Segment(s)
PositionSequence
38-42RRRRR
Subcellular Location(s) plas 10, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLWRVIVCVRVYYPVELIIFGIACQLFHPYPSIKSSRRRRRDVRPKLYVHAAVVNAPEPDRHESSPFRVRRTRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.18
4 0.16
5 0.15
6 0.11
7 0.09
8 0.08
9 0.09
10 0.06
11 0.06
12 0.06
13 0.09
14 0.09
15 0.09
16 0.11
17 0.11
18 0.13
19 0.16
20 0.22
21 0.24
22 0.34
23 0.44
24 0.53
25 0.61
26 0.68
27 0.72
28 0.78
29 0.84
30 0.85
31 0.84
32 0.83
33 0.77
34 0.72
35 0.7
36 0.6
37 0.5
38 0.42
39 0.32
40 0.24
41 0.22
42 0.19
43 0.15
44 0.13
45 0.13
46 0.13
47 0.18
48 0.21
49 0.22
50 0.26
51 0.29
52 0.37
53 0.45
54 0.47
55 0.49