Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PA75

Protein Details
Accession A0A165PA75    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
136-155YNDHCKTSYRIRQQTQRSACHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, cyto 5, cyto_mito 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR042448  CCNB1IP1  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000795  C:synaptonemal complex  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0007131  P:reciprocal meiotic recombination  
Amino Acid Sequences MDTELKCNRLTCRRVLVDKAVVVRSGSHIFCVDCANELFNNSRLCPACEIPLTEPDDVVVSSLHPSNDYKTSVLSGLTPSIILEICSRAIAFWQYQTHQENSFQQAVLRNLNDKNAQLQKQLDNVLREGQYVLNLYNDHCKTSYRIRQQTQRSAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.58
4 0.54
5 0.53
6 0.51
7 0.42
8 0.36
9 0.31
10 0.27
11 0.24
12 0.23
13 0.2
14 0.18
15 0.18
16 0.17
17 0.17
18 0.19
19 0.15
20 0.12
21 0.13
22 0.13
23 0.12
24 0.14
25 0.15
26 0.17
27 0.19
28 0.17
29 0.22
30 0.21
31 0.23
32 0.24
33 0.23
34 0.22
35 0.22
36 0.23
37 0.2
38 0.24
39 0.25
40 0.22
41 0.2
42 0.17
43 0.17
44 0.14
45 0.13
46 0.07
47 0.05
48 0.06
49 0.07
50 0.07
51 0.08
52 0.09
53 0.11
54 0.13
55 0.14
56 0.13
57 0.12
58 0.13
59 0.12
60 0.12
61 0.1
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.07
78 0.07
79 0.09
80 0.11
81 0.12
82 0.17
83 0.2
84 0.22
85 0.22
86 0.24
87 0.24
88 0.27
89 0.27
90 0.22
91 0.21
92 0.24
93 0.25
94 0.26
95 0.24
96 0.23
97 0.22
98 0.25
99 0.26
100 0.22
101 0.27
102 0.3
103 0.31
104 0.32
105 0.35
106 0.34
107 0.36
108 0.4
109 0.37
110 0.32
111 0.32
112 0.32
113 0.29
114 0.27
115 0.24
116 0.19
117 0.17
118 0.16
119 0.15
120 0.13
121 0.13
122 0.14
123 0.22
124 0.22
125 0.23
126 0.23
127 0.24
128 0.27
129 0.37
130 0.46
131 0.48
132 0.57
133 0.63
134 0.72
135 0.8