Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PQ99

Protein Details
Accession A0A165PQ99    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
159-179VDSIRKQRKIRARRKLISAWHHydrophilic
NLS Segment(s)
PositionSequence
163-173RKQRKIRARRK
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029149  Creatin/AminoP/Spt16_NTD  
IPR000587  Creatinase_N  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01321  Creatinase_N  
Amino Acid Sequences MSSMEFTKTSGKVEAVKARMKDEPDGALDYYIIPGNDAQEMVLHRPDARPLQWMCESRTVNSHLVVSRKKPKPDILVEACYANQVRQELRITNLKDDFDVVELSEECSNWIEWLASQAAKARVGIDPRMISYEESRILELRLAERNSDYKVIYPQKNYVDSIRKQRKIRARRKLISAWHFGPQARCTNADQTGNIKVQDVSRMEVPSRHPWTIIFRHASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.44
4 0.43
5 0.44
6 0.46
7 0.44
8 0.41
9 0.35
10 0.33
11 0.29
12 0.3
13 0.27
14 0.23
15 0.2
16 0.17
17 0.15
18 0.14
19 0.11
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.08
26 0.09
27 0.11
28 0.13
29 0.14
30 0.14
31 0.14
32 0.15
33 0.19
34 0.21
35 0.2
36 0.25
37 0.24
38 0.29
39 0.35
40 0.37
41 0.36
42 0.4
43 0.4
44 0.35
45 0.38
46 0.37
47 0.32
48 0.3
49 0.29
50 0.23
51 0.28
52 0.3
53 0.33
54 0.39
55 0.44
56 0.48
57 0.49
58 0.53
59 0.55
60 0.56
61 0.58
62 0.53
63 0.5
64 0.46
65 0.43
66 0.36
67 0.3
68 0.25
69 0.16
70 0.13
71 0.11
72 0.1
73 0.12
74 0.15
75 0.14
76 0.17
77 0.23
78 0.23
79 0.25
80 0.27
81 0.24
82 0.22
83 0.21
84 0.19
85 0.13
86 0.12
87 0.08
88 0.07
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.05
99 0.04
100 0.06
101 0.07
102 0.06
103 0.07
104 0.1
105 0.11
106 0.11
107 0.12
108 0.11
109 0.12
110 0.14
111 0.15
112 0.14
113 0.13
114 0.13
115 0.15
116 0.14
117 0.13
118 0.13
119 0.14
120 0.14
121 0.14
122 0.15
123 0.13
124 0.13
125 0.13
126 0.13
127 0.13
128 0.16
129 0.16
130 0.16
131 0.17
132 0.19
133 0.19
134 0.21
135 0.18
136 0.15
137 0.22
138 0.3
139 0.32
140 0.33
141 0.37
142 0.4
143 0.42
144 0.42
145 0.4
146 0.4
147 0.41
148 0.5
149 0.55
150 0.58
151 0.59
152 0.66
153 0.7
154 0.72
155 0.78
156 0.78
157 0.79
158 0.78
159 0.82
160 0.81
161 0.8
162 0.76
163 0.72
164 0.63
165 0.57
166 0.54
167 0.48
168 0.45
169 0.4
170 0.39
171 0.34
172 0.35
173 0.33
174 0.36
175 0.39
176 0.37
177 0.34
178 0.31
179 0.35
180 0.34
181 0.32
182 0.27
183 0.24
184 0.23
185 0.28
186 0.26
187 0.23
188 0.24
189 0.27
190 0.27
191 0.29
192 0.34
193 0.37
194 0.42
195 0.4
196 0.37
197 0.37
198 0.44
199 0.47
200 0.5