Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165V8W4

Protein Details
Accession A0A165V8W4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
261-291HTGPSGGESAKKRRKRRKKKKNVNPMGEGAGBasic
NLS Segment(s)
PositionSequence
269-282SAKKRRKRRKKKKN
Subcellular Location(s) nucl 16, cyto_nucl 14.5, cyto 11
Family & Domain DBs
Amino Acid Sequences MDVDDVDVDAETLQAQIDISTSLADDLVASWIKPAFKNSVGGSSAGRVTEKEIEEYVRRPPRLGVGAAVPGVAGREVMKLKGQLLASGKGKKRDRQEVHEMVVATRKRGDESEDEDSRAGAIRKKAKVDAFGGFGIKKGKGQSQTPLARPSAGSSAAVKTDGSKGEPGSVASPDESLASSHAASRKSSISNTNTKDNPQILVTQPASSIGVELSVLPASVNLSKNTKDTGPASRASDTPASLKQLSGSALPLLNLEGPPLHTGPSGGESAKKRRKRRKKKKNVNPMGEGAGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.05
13 0.05
14 0.08
15 0.09
16 0.08
17 0.1
18 0.12
19 0.15
20 0.16
21 0.19
22 0.21
23 0.22
24 0.27
25 0.27
26 0.31
27 0.29
28 0.29
29 0.27
30 0.24
31 0.23
32 0.19
33 0.18
34 0.13
35 0.15
36 0.2
37 0.2
38 0.2
39 0.2
40 0.23
41 0.26
42 0.27
43 0.33
44 0.35
45 0.35
46 0.33
47 0.33
48 0.36
49 0.37
50 0.36
51 0.28
52 0.22
53 0.23
54 0.22
55 0.21
56 0.14
57 0.1
58 0.1
59 0.08
60 0.06
61 0.04
62 0.08
63 0.09
64 0.1
65 0.12
66 0.13
67 0.14
68 0.18
69 0.17
70 0.18
71 0.2
72 0.24
73 0.27
74 0.34
75 0.36
76 0.41
77 0.46
78 0.48
79 0.53
80 0.59
81 0.61
82 0.6
83 0.67
84 0.63
85 0.6
86 0.57
87 0.5
88 0.39
89 0.4
90 0.32
91 0.23
92 0.21
93 0.19
94 0.17
95 0.17
96 0.2
97 0.18
98 0.23
99 0.3
100 0.28
101 0.29
102 0.27
103 0.26
104 0.23
105 0.21
106 0.16
107 0.13
108 0.17
109 0.24
110 0.26
111 0.28
112 0.32
113 0.32
114 0.34
115 0.33
116 0.3
117 0.25
118 0.23
119 0.22
120 0.17
121 0.17
122 0.16
123 0.13
124 0.13
125 0.12
126 0.15
127 0.18
128 0.19
129 0.22
130 0.29
131 0.34
132 0.34
133 0.36
134 0.32
135 0.29
136 0.27
137 0.25
138 0.18
139 0.14
140 0.12
141 0.1
142 0.11
143 0.1
144 0.11
145 0.09
146 0.08
147 0.1
148 0.1
149 0.1
150 0.11
151 0.11
152 0.12
153 0.12
154 0.12
155 0.1
156 0.1
157 0.1
158 0.09
159 0.09
160 0.07
161 0.08
162 0.07
163 0.06
164 0.06
165 0.07
166 0.07
167 0.09
168 0.12
169 0.13
170 0.13
171 0.15
172 0.17
173 0.18
174 0.2
175 0.24
176 0.27
177 0.34
178 0.37
179 0.41
180 0.4
181 0.4
182 0.43
183 0.37
184 0.33
185 0.26
186 0.25
187 0.2
188 0.25
189 0.24
190 0.19
191 0.18
192 0.17
193 0.17
194 0.14
195 0.13
196 0.07
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.04
204 0.05
205 0.06
206 0.1
207 0.12
208 0.13
209 0.17
210 0.18
211 0.2
212 0.22
213 0.21
214 0.21
215 0.23
216 0.28
217 0.28
218 0.3
219 0.32
220 0.32
221 0.32
222 0.32
223 0.31
224 0.25
225 0.25
226 0.24
227 0.26
228 0.24
229 0.24
230 0.21
231 0.21
232 0.21
233 0.18
234 0.16
235 0.13
236 0.13
237 0.13
238 0.13
239 0.12
240 0.12
241 0.11
242 0.1
243 0.09
244 0.1
245 0.13
246 0.13
247 0.13
248 0.12
249 0.12
250 0.13
251 0.15
252 0.16
253 0.14
254 0.2
255 0.25
256 0.36
257 0.45
258 0.53
259 0.61
260 0.71
261 0.82
262 0.87
263 0.93
264 0.93
265 0.95
266 0.97
267 0.97
268 0.98
269 0.97
270 0.95
271 0.9
272 0.83
273 0.76