Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165V2P6

Protein Details
Accession A0A165V2P6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-109GCSSSFRTRCRLRHRTREFFSFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR040023  WBP4  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50171  ZF_MATRIN  
Amino Acid Sequences MSEYWVSKKKYYCKYCEIYITDDAPSRRQHENGLRHQGNKERFVRGLYKASEKRKQDTEEEKREMARVEQVRALSLLCLLYSSVYPGCSSSFRTRCRLRHRTREFFSFFSTRRFLLSKTHRSAETF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.68
4 0.62
5 0.56
6 0.51
7 0.45
8 0.38
9 0.37
10 0.33
11 0.29
12 0.3
13 0.3
14 0.29
15 0.29
16 0.35
17 0.4
18 0.47
19 0.52
20 0.59
21 0.58
22 0.57
23 0.59
24 0.59
25 0.55
26 0.54
27 0.48
28 0.4
29 0.39
30 0.39
31 0.39
32 0.35
33 0.35
34 0.3
35 0.36
36 0.39
37 0.46
38 0.5
39 0.49
40 0.5
41 0.5
42 0.5
43 0.49
44 0.53
45 0.55
46 0.56
47 0.56
48 0.52
49 0.47
50 0.45
51 0.38
52 0.28
53 0.26
54 0.19
55 0.18
56 0.19
57 0.18
58 0.18
59 0.18
60 0.17
61 0.1
62 0.09
63 0.07
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.08
74 0.09
75 0.1
76 0.16
77 0.24
78 0.31
79 0.34
80 0.43
81 0.5
82 0.57
83 0.67
84 0.73
85 0.73
86 0.77
87 0.83
88 0.85
89 0.82
90 0.83
91 0.76
92 0.68
93 0.64
94 0.6
95 0.52
96 0.47
97 0.44
98 0.36
99 0.35
100 0.35
101 0.3
102 0.33
103 0.42
104 0.46
105 0.5
106 0.55