Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165V9C8

Protein Details
Accession A0A165V9C8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-39ETYKAYKPPRPSSRNNGKPSAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004345  TB2_DP1_HVA22  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03134  TB2_DP1_HVA22  
Amino Acid Sequences MPVVVPILRLSVLFLNVWETYKAYKPPRPSSRNNGKPSARAMTQRKRNMKGCLAVWIVWCCFALYEGTLDGIVGIFIPFYEEIKALLLLFMLLTRARGAEPIYLHVIRPLLKPYAPLLDSMLEAAALFGGLLIMLVSIPVQSVTSWWSRAESAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.16
5 0.14
6 0.14
7 0.15
8 0.2
9 0.27
10 0.32
11 0.37
12 0.44
13 0.54
14 0.64
15 0.68
16 0.72
17 0.75
18 0.79
19 0.83
20 0.8
21 0.78
22 0.71
23 0.67
24 0.64
25 0.58
26 0.5
27 0.49
28 0.52
29 0.53
30 0.6
31 0.65
32 0.69
33 0.71
34 0.73
35 0.71
36 0.67
37 0.62
38 0.53
39 0.49
40 0.43
41 0.36
42 0.32
43 0.28
44 0.22
45 0.18
46 0.17
47 0.11
48 0.09
49 0.08
50 0.07
51 0.05
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.03
65 0.03
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.03
78 0.04
79 0.03
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.09
87 0.1
88 0.12
89 0.16
90 0.16
91 0.16
92 0.17
93 0.17
94 0.16
95 0.17
96 0.18
97 0.16
98 0.16
99 0.17
100 0.18
101 0.22
102 0.21
103 0.2
104 0.19
105 0.17
106 0.17
107 0.16
108 0.14
109 0.08
110 0.07
111 0.06
112 0.04
113 0.03
114 0.03
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.04
127 0.04
128 0.04
129 0.05
130 0.09
131 0.12
132 0.14
133 0.15
134 0.17