Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NXP4

Protein Details
Accession A0A165NXP4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MRGRGRCRGRKCARWRWRRGECFGCLBasic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10, cyto 3.5, plas 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRGRGRCRGRKCARWRWRRGECFGCLCACDDSGLMNECLVDVKEACTNGERHSGDLGFFELFAVESGTFVTVIIAVIISCTLSSPASLIGIVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.9
4 0.91
5 0.88
6 0.86
7 0.81
8 0.76
9 0.7
10 0.62
11 0.52
12 0.41
13 0.35
14 0.28
15 0.21
16 0.16
17 0.11
18 0.1
19 0.1
20 0.11
21 0.09
22 0.08
23 0.08
24 0.07
25 0.08
26 0.07
27 0.06
28 0.05
29 0.06
30 0.07
31 0.08
32 0.08
33 0.1
34 0.1
35 0.11
36 0.18
37 0.17
38 0.17
39 0.18
40 0.18
41 0.16
42 0.16
43 0.15
44 0.08
45 0.08
46 0.07
47 0.05
48 0.05
49 0.05
50 0.06
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.03
67 0.04
68 0.05
69 0.05
70 0.06
71 0.06
72 0.07
73 0.08
74 0.08