Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UG86

Protein Details
Accession A0A165UG86    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25AVAQYLRKQRRTKRKHLPEKVLLAVHydrophilic
NLS Segment(s)
PositionSequence
9-15QRRTKRK
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences AVAQYLRKQRRTKRKHLPEKVLLAVGMKVMVTSNLATDLDIANGSRGEVVKIVLDPEEPPLTDEAVVELKRLPAYVLVRLDRTRMPQLPGLEEHVVPIEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.93
4 0.92
5 0.89
6 0.85
7 0.77
8 0.66
9 0.55
10 0.45
11 0.34
12 0.24
13 0.16
14 0.09
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.06
39 0.06
40 0.05
41 0.06
42 0.06
43 0.08
44 0.08
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.08
51 0.07
52 0.1
53 0.1
54 0.1
55 0.1
56 0.11
57 0.11
58 0.11
59 0.1
60 0.11
61 0.13
62 0.18
63 0.22
64 0.23
65 0.27
66 0.27
67 0.3
68 0.28
69 0.31
70 0.34
71 0.33
72 0.34
73 0.36
74 0.38
75 0.39
76 0.39
77 0.39
78 0.34
79 0.3
80 0.27