Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4TUR7

Protein Details
Accession J4TUR7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
124-147AILKAKLRQKQKYLKDLQKKNGSHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 5, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040463  BAP29/BAP31_N  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05529  Bap31  
Amino Acid Sequences MAILFVLVLPLPQRVRKWLYMRCTAIGSNKKFRTYMVGIMIFVGLLFIDSWKRSQIKVSTYHSQKPPYVINSVTPVDALASRAYNQRNVYISGFIIYFCICILTVMSILRRIVEWNDKIRAGDAILKAKLRQKQKYLKDLQKKNGSHIHTYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.4
4 0.48
5 0.51
6 0.55
7 0.6
8 0.61
9 0.56
10 0.53
11 0.47
12 0.48
13 0.49
14 0.48
15 0.49
16 0.5
17 0.5
18 0.48
19 0.46
20 0.45
21 0.39
22 0.38
23 0.34
24 0.31
25 0.28
26 0.28
27 0.28
28 0.19
29 0.15
30 0.1
31 0.04
32 0.03
33 0.03
34 0.03
35 0.05
36 0.06
37 0.07
38 0.11
39 0.13
40 0.13
41 0.19
42 0.23
43 0.26
44 0.32
45 0.37
46 0.42
47 0.45
48 0.51
49 0.5
50 0.49
51 0.45
52 0.41
53 0.39
54 0.32
55 0.3
56 0.24
57 0.22
58 0.22
59 0.21
60 0.18
61 0.14
62 0.12
63 0.1
64 0.09
65 0.09
66 0.06
67 0.06
68 0.07
69 0.11
70 0.12
71 0.16
72 0.16
73 0.18
74 0.19
75 0.21
76 0.21
77 0.18
78 0.17
79 0.14
80 0.13
81 0.1
82 0.09
83 0.07
84 0.06
85 0.05
86 0.05
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.1
98 0.1
99 0.13
100 0.21
101 0.24
102 0.28
103 0.31
104 0.32
105 0.32
106 0.31
107 0.28
108 0.21
109 0.23
110 0.21
111 0.24
112 0.25
113 0.26
114 0.29
115 0.34
116 0.39
117 0.43
118 0.47
119 0.52
120 0.6
121 0.68
122 0.75
123 0.8
124 0.84
125 0.85
126 0.86
127 0.87
128 0.86
129 0.79
130 0.76
131 0.74
132 0.68