Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165T474

Protein Details
Accession A0A165T474   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-38GLPPMPPKKHARNKPSGTPPPPHydrophilic
NLS Segment(s)
PositionSequence
23-30PKKHARNK
Subcellular Location(s) cyto 14.5, cyto_nucl 10, mito 5, extr 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001338  Hydrophobin  
Gene Ontology GO:0005576  C:extracellular region  
GO:0009277  C:fungal-type cell wall  
GO:0005199  F:structural constituent of cell wall  
Pfam View protein in Pfam  
PF01185  Hydrophobin  
CDD cd23507  hydrophobin_I  
Amino Acid Sequences AVDALATPTNADRMARGLPPMPPKKHARNKPSGTPPPPPTPTGGTSGSCNTGSVQCCNSVQSAGDGGMPGILGLLGLPADPDVLVGTNCSPIDVLGLGAGASCTAHPVCCEDNSHGGLISIGCIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.18
4 0.18
5 0.23
6 0.33
7 0.41
8 0.42
9 0.46
10 0.53
11 0.61
12 0.69
13 0.74
14 0.73
15 0.75
16 0.78
17 0.81
18 0.83
19 0.82
20 0.76
21 0.75
22 0.71
23 0.68
24 0.64
25 0.56
26 0.48
27 0.43
28 0.39
29 0.35
30 0.32
31 0.24
32 0.24
33 0.24
34 0.23
35 0.19
36 0.17
37 0.14
38 0.16
39 0.16
40 0.16
41 0.16
42 0.15
43 0.15
44 0.15
45 0.15
46 0.11
47 0.1
48 0.08
49 0.08
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.03
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.03
70 0.04
71 0.04
72 0.05
73 0.05
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.08
80 0.07
81 0.07
82 0.04
83 0.05
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.06
91 0.06
92 0.07
93 0.08
94 0.12
95 0.14
96 0.16
97 0.2
98 0.21
99 0.26
100 0.28
101 0.28
102 0.24
103 0.22
104 0.2
105 0.17