Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TDT3

Protein Details
Accession A0A165TDT3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-56QELLRWKWSKWRREREETLRTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences SRGLDPVLGVFTGILAYYLYETHPRTAPPPDQRLQELLRWKWSKWRREREETLRTAEMRSTQSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.05
6 0.06
7 0.1
8 0.12
9 0.14
10 0.15
11 0.15
12 0.17
13 0.22
14 0.28
15 0.31
16 0.36
17 0.37
18 0.38
19 0.38
20 0.39
21 0.36
22 0.33
23 0.34
24 0.29
25 0.35
26 0.35
27 0.34
28 0.41
29 0.47
30 0.53
31 0.56
32 0.66
33 0.65
34 0.73
35 0.83
36 0.82
37 0.84
38 0.78
39 0.74
40 0.67
41 0.59
42 0.51
43 0.44
44 0.39
45 0.33