Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165T2W6

Protein Details
Accession A0A165T2W6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
305-330RPESKVRKAVEKRRADPKRGRHFDGLBasic
NLS Segment(s)
PositionSequence
309-325KVRKAVEKRRADPKRGR
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014729  Rossmann-like_a/b/a_fold  
IPR006016  UspA  
Pfam View protein in Pfam  
PF00582  Usp  
CDD cd00293  USP_Like  
Amino Acid Sequences MSESRQGSPLPHPSHITLPAPVPLRSAMKHNSAGSRPSTPGSPAQIGAVLPRTSTHTSISGLSTVSNSPSPSPYQSHAHASPIPYHIQNNSLSAMPSPSPSSLPLPSSPLLSPSPSTPMPIAGYTPKVSFDTFEDPSSSMFSYTLRVKSDGFEKGKGTRVFLCASSPDQSGLQALDWACESLVQEGDELIVLRGVGEEELQKPHGFVRDSAHELIRYLQEKCIESDPDRKLSLIVEFVAGKITTTIDRLIALYRPDALVVGTRGQRGLVSWGVSGLIGVGGSGSGVGSVSKYCLSHSPVPIIVVRPESKVRKAVEKRRADPKRGRHFDGLPGLSPATTRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.42
4 0.35
5 0.32
6 0.34
7 0.34
8 0.31
9 0.28
10 0.26
11 0.28
12 0.27
13 0.31
14 0.31
15 0.34
16 0.39
17 0.41
18 0.44
19 0.43
20 0.46
21 0.43
22 0.42
23 0.38
24 0.35
25 0.33
26 0.29
27 0.31
28 0.32
29 0.3
30 0.26
31 0.25
32 0.25
33 0.23
34 0.22
35 0.23
36 0.17
37 0.15
38 0.15
39 0.2
40 0.22
41 0.23
42 0.23
43 0.2
44 0.22
45 0.23
46 0.24
47 0.19
48 0.16
49 0.15
50 0.14
51 0.13
52 0.13
53 0.14
54 0.13
55 0.14
56 0.16
57 0.18
58 0.2
59 0.23
60 0.25
61 0.28
62 0.3
63 0.35
64 0.33
65 0.35
66 0.34
67 0.32
68 0.32
69 0.3
70 0.3
71 0.25
72 0.25
73 0.22
74 0.23
75 0.23
76 0.21
77 0.19
78 0.17
79 0.16
80 0.15
81 0.16
82 0.12
83 0.13
84 0.13
85 0.12
86 0.13
87 0.14
88 0.17
89 0.17
90 0.19
91 0.18
92 0.21
93 0.2
94 0.21
95 0.2
96 0.2
97 0.19
98 0.18
99 0.18
100 0.15
101 0.19
102 0.16
103 0.18
104 0.15
105 0.15
106 0.15
107 0.15
108 0.15
109 0.13
110 0.15
111 0.15
112 0.15
113 0.15
114 0.15
115 0.15
116 0.14
117 0.15
118 0.18
119 0.18
120 0.19
121 0.18
122 0.17
123 0.18
124 0.18
125 0.15
126 0.1
127 0.09
128 0.09
129 0.11
130 0.14
131 0.16
132 0.15
133 0.16
134 0.16
135 0.18
136 0.21
137 0.26
138 0.24
139 0.24
140 0.24
141 0.25
142 0.33
143 0.32
144 0.3
145 0.24
146 0.24
147 0.24
148 0.22
149 0.21
150 0.15
151 0.16
152 0.16
153 0.14
154 0.12
155 0.11
156 0.11
157 0.11
158 0.09
159 0.07
160 0.07
161 0.07
162 0.07
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.06
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.05
185 0.06
186 0.08
187 0.09
188 0.09
189 0.1
190 0.11
191 0.15
192 0.14
193 0.15
194 0.17
195 0.21
196 0.24
197 0.25
198 0.25
199 0.21
200 0.2
201 0.21
202 0.21
203 0.19
204 0.17
205 0.17
206 0.2
207 0.21
208 0.23
209 0.24
210 0.23
211 0.24
212 0.32
213 0.33
214 0.33
215 0.33
216 0.31
217 0.28
218 0.25
219 0.24
220 0.16
221 0.13
222 0.11
223 0.1
224 0.1
225 0.11
226 0.1
227 0.08
228 0.07
229 0.08
230 0.07
231 0.09
232 0.09
233 0.08
234 0.09
235 0.09
236 0.1
237 0.12
238 0.12
239 0.12
240 0.12
241 0.12
242 0.11
243 0.11
244 0.09
245 0.1
246 0.1
247 0.14
248 0.15
249 0.16
250 0.16
251 0.16
252 0.16
253 0.14
254 0.16
255 0.14
256 0.13
257 0.13
258 0.13
259 0.13
260 0.12
261 0.11
262 0.07
263 0.05
264 0.04
265 0.03
266 0.03
267 0.02
268 0.03
269 0.03
270 0.02
271 0.02
272 0.03
273 0.03
274 0.04
275 0.04
276 0.06
277 0.08
278 0.09
279 0.1
280 0.15
281 0.22
282 0.28
283 0.31
284 0.34
285 0.33
286 0.35
287 0.36
288 0.34
289 0.3
290 0.29
291 0.27
292 0.27
293 0.34
294 0.38
295 0.4
296 0.45
297 0.45
298 0.5
299 0.59
300 0.66
301 0.68
302 0.73
303 0.75
304 0.79
305 0.85
306 0.83
307 0.83
308 0.83
309 0.85
310 0.82
311 0.82
312 0.78
313 0.72
314 0.72
315 0.71
316 0.63
317 0.53
318 0.48
319 0.41
320 0.34