Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SIT6

Protein Details
Accession A0A165SIT6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-98HALRSHWKGKVHKRRCKQLRGPAYTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHGGNRDVHRAGRTRARTKDLDQIQLIDLDPKVRAKLEAQPRDYEKPGLAQHYCVECAKYFETDHALRSHWKGKVHKRRCKQLRGPAYTIEDSERAAGLGREGKRSLLSAVSAPTPMSVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.68
3 0.61
4 0.55
5 0.5
6 0.47
7 0.48
8 0.52
9 0.52
10 0.55
11 0.59
12 0.58
13 0.57
14 0.62
15 0.57
16 0.54
17 0.46
18 0.42
19 0.36
20 0.32
21 0.29
22 0.21
23 0.17
24 0.12
25 0.12
26 0.11
27 0.12
28 0.11
29 0.12
30 0.12
31 0.2
32 0.3
33 0.36
34 0.38
35 0.41
36 0.45
37 0.48
38 0.47
39 0.4
40 0.3
41 0.27
42 0.26
43 0.26
44 0.22
45 0.19
46 0.2
47 0.2
48 0.21
49 0.17
50 0.16
51 0.12
52 0.14
53 0.14
54 0.13
55 0.11
56 0.11
57 0.16
58 0.15
59 0.17
60 0.16
61 0.16
62 0.17
63 0.2
64 0.25
65 0.24
66 0.29
67 0.36
68 0.46
69 0.56
70 0.65
71 0.71
72 0.74
73 0.82
74 0.85
75 0.87
76 0.86
77 0.85
78 0.85
79 0.83
80 0.77
81 0.7
82 0.66
83 0.56
84 0.48
85 0.4
86 0.3
87 0.23
88 0.2
89 0.16
90 0.1
91 0.1
92 0.09
93 0.09
94 0.16
95 0.17
96 0.2
97 0.21
98 0.22
99 0.23
100 0.24
101 0.23
102 0.18
103 0.18
104 0.16
105 0.18
106 0.18
107 0.17
108 0.16
109 0.15