Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165RXN4

Protein Details
Accession A0A165RXN4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
208-227YSKFGVTKKTKKNSDDKVEVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 8, mito 6, plas 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011576  Pyridox_Oxase_put  
IPR012349  Split_barrel_FMN-bd  
Pfam View protein in Pfam  
PF01243  Putative_PNPOx  
Amino Acid Sequences MGKFYDDIPPHIIEWVEKQHMFTVATAPLSATGHVNVSTKGVGGTFHVVDSKTVWYEDLTGSGSETIAHLRENGRITILFSAFEGPPVICRVFGTGKVHEFGSPEYSSYAPPANRTPGSRSVIVVDVHKVGTSCGFGVPFYEFIGHRETLLNTASMFEKRDLATPDNIADNGLKAYWRRMNSESIDGLPALTEVPHQSHLPLDAVHDYSKFGVTKKTKKNSDDKVEVKVKGLGSAWISGDEVKLALAFLFGAIISTFFARITGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.27
5 0.28
6 0.29
7 0.32
8 0.31
9 0.27
10 0.23
11 0.19
12 0.19
13 0.18
14 0.16
15 0.15
16 0.14
17 0.14
18 0.12
19 0.1
20 0.11
21 0.13
22 0.14
23 0.13
24 0.14
25 0.13
26 0.12
27 0.11
28 0.1
29 0.09
30 0.1
31 0.13
32 0.12
33 0.12
34 0.13
35 0.14
36 0.14
37 0.15
38 0.15
39 0.13
40 0.13
41 0.13
42 0.11
43 0.13
44 0.13
45 0.13
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.09
57 0.1
58 0.14
59 0.16
60 0.16
61 0.16
62 0.15
63 0.16
64 0.17
65 0.17
66 0.13
67 0.11
68 0.13
69 0.12
70 0.12
71 0.12
72 0.08
73 0.09
74 0.12
75 0.12
76 0.09
77 0.09
78 0.12
79 0.13
80 0.17
81 0.19
82 0.19
83 0.21
84 0.22
85 0.22
86 0.19
87 0.19
88 0.16
89 0.16
90 0.14
91 0.13
92 0.13
93 0.13
94 0.13
95 0.13
96 0.16
97 0.12
98 0.14
99 0.16
100 0.19
101 0.2
102 0.22
103 0.25
104 0.28
105 0.3
106 0.29
107 0.27
108 0.24
109 0.25
110 0.24
111 0.2
112 0.14
113 0.12
114 0.11
115 0.11
116 0.1
117 0.07
118 0.07
119 0.07
120 0.06
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.06
127 0.06
128 0.08
129 0.07
130 0.09
131 0.12
132 0.11
133 0.11
134 0.12
135 0.12
136 0.12
137 0.13
138 0.11
139 0.08
140 0.09
141 0.1
142 0.09
143 0.11
144 0.1
145 0.11
146 0.12
147 0.15
148 0.18
149 0.19
150 0.19
151 0.19
152 0.19
153 0.18
154 0.18
155 0.15
156 0.11
157 0.1
158 0.08
159 0.07
160 0.08
161 0.07
162 0.13
163 0.17
164 0.19
165 0.23
166 0.25
167 0.3
168 0.32
169 0.35
170 0.31
171 0.27
172 0.26
173 0.21
174 0.19
175 0.13
176 0.11
177 0.07
178 0.06
179 0.06
180 0.06
181 0.08
182 0.1
183 0.1
184 0.11
185 0.12
186 0.13
187 0.13
188 0.12
189 0.12
190 0.12
191 0.14
192 0.15
193 0.14
194 0.13
195 0.13
196 0.16
197 0.15
198 0.14
199 0.22
200 0.3
201 0.4
202 0.49
203 0.58
204 0.63
205 0.69
206 0.78
207 0.79
208 0.8
209 0.8
210 0.73
211 0.72
212 0.71
213 0.64
214 0.57
215 0.51
216 0.41
217 0.34
218 0.31
219 0.25
220 0.2
221 0.21
222 0.19
223 0.16
224 0.16
225 0.14
226 0.14
227 0.11
228 0.1
229 0.07
230 0.07
231 0.06
232 0.05
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.05
241 0.06
242 0.07
243 0.07
244 0.07
245 0.08