Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4U3Y3

Protein Details
Accession J4U3Y3    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
255-274ITAAEKSFKAPKNKYKVVRRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002778  Signal_recog_particle_SRP19  
IPR036521  SRP19-like_sf  
IPR022938  SRP19_arc-type  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF01922  SRP19  
Amino Acid Sequences MPRLEEIDDYNDVDDLDMDLAELDPSLRTPIAPKITTTVVRSQDQESPALFPEMNSNSNDNNNSNSSEKEQLSFINPKTGKVERSETISRKDLEEVKRFQILYPCYFDVNRSHKEGRRVPKDLAVENPLAKTMADAVRELGILCIFEGEKCHPQDFGNPGRVRVLFKENGQLVGAATTFKGGKRQLIKAVGEYMKKHPTTIESLREIPYGPDFDNIEFKEIPRVKGFKMNVIVPLHSPFLMGHPMTKSVYETPKITAAEKSFKAPKNKYKVVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.09
3 0.08
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.05
11 0.05
12 0.06
13 0.08
14 0.08
15 0.08
16 0.11
17 0.19
18 0.26
19 0.26
20 0.27
21 0.28
22 0.33
23 0.36
24 0.37
25 0.37
26 0.35
27 0.36
28 0.38
29 0.37
30 0.38
31 0.36
32 0.35
33 0.28
34 0.25
35 0.24
36 0.23
37 0.2
38 0.15
39 0.2
40 0.21
41 0.22
42 0.22
43 0.23
44 0.23
45 0.27
46 0.3
47 0.24
48 0.24
49 0.24
50 0.26
51 0.25
52 0.25
53 0.25
54 0.28
55 0.27
56 0.25
57 0.24
58 0.22
59 0.25
60 0.29
61 0.26
62 0.3
63 0.3
64 0.3
65 0.34
66 0.36
67 0.33
68 0.31
69 0.36
70 0.27
71 0.34
72 0.4
73 0.38
74 0.4
75 0.42
76 0.39
77 0.35
78 0.37
79 0.37
80 0.37
81 0.41
82 0.39
83 0.37
84 0.4
85 0.39
86 0.36
87 0.36
88 0.32
89 0.28
90 0.29
91 0.27
92 0.25
93 0.25
94 0.25
95 0.27
96 0.3
97 0.29
98 0.31
99 0.35
100 0.37
101 0.45
102 0.51
103 0.53
104 0.54
105 0.55
106 0.51
107 0.51
108 0.51
109 0.44
110 0.39
111 0.32
112 0.26
113 0.23
114 0.22
115 0.16
116 0.14
117 0.12
118 0.09
119 0.09
120 0.09
121 0.09
122 0.09
123 0.1
124 0.1
125 0.1
126 0.1
127 0.07
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.06
135 0.08
136 0.13
137 0.14
138 0.15
139 0.15
140 0.16
141 0.21
142 0.24
143 0.26
144 0.3
145 0.29
146 0.3
147 0.31
148 0.32
149 0.29
150 0.26
151 0.28
152 0.21
153 0.21
154 0.27
155 0.25
156 0.25
157 0.23
158 0.2
159 0.15
160 0.13
161 0.12
162 0.06
163 0.06
164 0.06
165 0.07
166 0.07
167 0.12
168 0.12
169 0.18
170 0.23
171 0.27
172 0.32
173 0.36
174 0.37
175 0.34
176 0.39
177 0.37
178 0.35
179 0.34
180 0.34
181 0.36
182 0.35
183 0.33
184 0.28
185 0.27
186 0.32
187 0.35
188 0.36
189 0.32
190 0.35
191 0.36
192 0.35
193 0.32
194 0.26
195 0.23
196 0.2
197 0.16
198 0.17
199 0.17
200 0.17
201 0.23
202 0.22
203 0.24
204 0.22
205 0.21
206 0.29
207 0.3
208 0.32
209 0.32
210 0.34
211 0.32
212 0.4
213 0.41
214 0.38
215 0.4
216 0.39
217 0.39
218 0.39
219 0.38
220 0.31
221 0.33
222 0.27
223 0.22
224 0.21
225 0.15
226 0.15
227 0.19
228 0.18
229 0.18
230 0.18
231 0.21
232 0.22
233 0.22
234 0.23
235 0.24
236 0.31
237 0.32
238 0.31
239 0.31
240 0.36
241 0.37
242 0.35
243 0.35
244 0.33
245 0.38
246 0.38
247 0.42
248 0.45
249 0.5
250 0.59
251 0.62
252 0.67
253 0.69
254 0.77