Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NNL2

Protein Details
Accession A0A165NNL2    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-116EYQPSQRVRKRRHGFLARKKSQHGPKILARRRAKGRKFBasic
NLS Segment(s)
PositionSequence
85-116RVRKRRHGFLARKKSQHGPKILARRRAKGRKF
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRILKQVAQLLARPPALPHASSVVSTLTGLHRPSSQRLTPLPFALAFQSSSLLTPSFVGRSSALLQLNQVRWGSRGTEYQPSQRVRKRRHGFLARKKSQHGPKILARRRAKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.26
4 0.26
5 0.24
6 0.22
7 0.21
8 0.21
9 0.21
10 0.21
11 0.15
12 0.13
13 0.12
14 0.12
15 0.11
16 0.13
17 0.13
18 0.14
19 0.16
20 0.19
21 0.23
22 0.28
23 0.28
24 0.29
25 0.32
26 0.36
27 0.34
28 0.33
29 0.29
30 0.23
31 0.22
32 0.19
33 0.16
34 0.11
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.09
49 0.1
50 0.13
51 0.13
52 0.13
53 0.14
54 0.17
55 0.17
56 0.18
57 0.16
58 0.13
59 0.14
60 0.15
61 0.15
62 0.14
63 0.16
64 0.17
65 0.25
66 0.27
67 0.32
68 0.38
69 0.41
70 0.47
71 0.5
72 0.57
73 0.57
74 0.66
75 0.68
76 0.69
77 0.76
78 0.78
79 0.83
80 0.84
81 0.88
82 0.85
83 0.82
84 0.78
85 0.77
86 0.75
87 0.73
88 0.68
89 0.64
90 0.64
91 0.71
92 0.74
93 0.75
94 0.72
95 0.73
96 0.77
97 0.81
98 0.79
99 0.79