Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MV95

Protein Details
Accession A0A165MV95    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
80-108DVEDRKKRGKGAPTKAKNKEESRRTQRRRBasic
NLS Segment(s)
PositionSequence
84-108RKKRGKGAPTKAKNKEESRRTQRRR
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MASIAPSALATLNRVRCQIFQTAYNPTSTRTGAKYLRKRLRGPSMMKYYPPYQQLSLAKLMKDYPEWDIVDEEEQIRLRDVEDRKKRGKGAPTKAKNKEESRRTQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.31
5 0.35
6 0.3
7 0.29
8 0.3
9 0.35
10 0.34
11 0.35
12 0.32
13 0.28
14 0.28
15 0.25
16 0.25
17 0.19
18 0.25
19 0.29
20 0.39
21 0.46
22 0.54
23 0.61
24 0.64
25 0.66
26 0.68
27 0.71
28 0.69
29 0.65
30 0.62
31 0.62
32 0.57
33 0.55
34 0.5
35 0.42
36 0.38
37 0.37
38 0.3
39 0.22
40 0.26
41 0.27
42 0.26
43 0.29
44 0.26
45 0.23
46 0.22
47 0.22
48 0.17
49 0.16
50 0.15
51 0.12
52 0.15
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.14
59 0.12
60 0.1
61 0.11
62 0.1
63 0.11
64 0.1
65 0.1
66 0.16
67 0.22
68 0.31
69 0.39
70 0.47
71 0.52
72 0.57
73 0.62
74 0.62
75 0.66
76 0.66
77 0.67
78 0.71
79 0.75
80 0.8
81 0.85
82 0.85
83 0.84
84 0.83
85 0.82
86 0.81
87 0.82
88 0.82