Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165UR39

Protein Details
Accession A0A165UR39    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MYIKKLKARPRKNPPVNFCAPEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MYIKKLKARPRKNPPVNFCAPELAGLLACWAASGDLGSTTACMQTSQALYDCMRSVPFKSKQHRPTINYHLARLGKNLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.82
4 0.74
5 0.64
6 0.55
7 0.44
8 0.35
9 0.28
10 0.2
11 0.13
12 0.1
13 0.09
14 0.06
15 0.05
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.03
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.08
34 0.08
35 0.1
36 0.1
37 0.11
38 0.12
39 0.1
40 0.12
41 0.12
42 0.14
43 0.21
44 0.29
45 0.37
46 0.44
47 0.54
48 0.61
49 0.7
50 0.76
51 0.72
52 0.73
53 0.74
54 0.77
55 0.69
56 0.63
57 0.6
58 0.55
59 0.51