Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UKS1

Protein Details
Accession A0A165UKS1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-101TWTVCQRNRNEERRRIQQVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences SSKRPVYKAETTGSYWGDVKAAASRLSPDDFSHIGEMPCARSSLLNGIAAGAGVGIVRGIGAGPFVASNWAVGTFMLISIGTWTVCQRNRNEERRRIQQVIEEMPRRYVVKKEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.24
4 0.2
5 0.16
6 0.14
7 0.13
8 0.14
9 0.13
10 0.13
11 0.14
12 0.17
13 0.18
14 0.19
15 0.16
16 0.18
17 0.18
18 0.19
19 0.19
20 0.18
21 0.16
22 0.16
23 0.16
24 0.13
25 0.13
26 0.12
27 0.1
28 0.09
29 0.1
30 0.13
31 0.14
32 0.12
33 0.11
34 0.11
35 0.11
36 0.1
37 0.09
38 0.05
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.07
71 0.13
72 0.17
73 0.22
74 0.25
75 0.35
76 0.44
77 0.54
78 0.62
79 0.67
80 0.71
81 0.76
82 0.81
83 0.73
84 0.66
85 0.61
86 0.59
87 0.57
88 0.57
89 0.52
90 0.45
91 0.44
92 0.46
93 0.42
94 0.38
95 0.36