Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165T303

Protein Details
Accession A0A165T303   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
105-124MGAHRRRLSRLQTRKPSSHDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 7.833, mito 7.5, cyto 7, cyto_nucl 6.833, nucl 5.5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010929  PDR_CDR_ABC  
Gene Ontology GO:0016020  C:membrane  
GO:0005524  F:ATP binding  
GO:0042626  F:ATPase-coupled transmembrane transporter activity  
Pfam View protein in Pfam  
PF06422  PDR_CDR  
Amino Acid Sequences AVGKTLISCSDVEYVTLTPPSGLTCGDYMQAFISYAGGYLVDPNATSGCQFCSSRTTDELLGKYFNIQYAHRWRNFGLLLVYTAFNTAAIYVFTYVFRIRSGNPMGAHRRRLSRLQTRKPSSHDSLGVHVNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.13
5 0.1
6 0.1
7 0.11
8 0.1
9 0.09
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.1
16 0.1
17 0.1
18 0.09
19 0.08
20 0.08
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.1
37 0.11
38 0.11
39 0.14
40 0.17
41 0.19
42 0.2
43 0.2
44 0.19
45 0.22
46 0.22
47 0.2
48 0.18
49 0.15
50 0.15
51 0.13
52 0.13
53 0.12
54 0.11
55 0.16
56 0.25
57 0.31
58 0.31
59 0.33
60 0.31
61 0.33
62 0.33
63 0.28
64 0.2
65 0.14
66 0.13
67 0.13
68 0.13
69 0.09
70 0.09
71 0.07
72 0.06
73 0.06
74 0.05
75 0.04
76 0.04
77 0.05
78 0.06
79 0.06
80 0.06
81 0.08
82 0.09
83 0.09
84 0.1
85 0.11
86 0.11
87 0.17
88 0.21
89 0.24
90 0.25
91 0.32
92 0.4
93 0.45
94 0.5
95 0.48
96 0.52
97 0.52
98 0.57
99 0.6
100 0.61
101 0.67
102 0.71
103 0.77
104 0.79
105 0.8
106 0.79
107 0.78
108 0.74
109 0.69
110 0.64
111 0.56
112 0.52