Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165UI72

Protein Details
Accession A0A165UI72    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-82QAYRTRIKRQWQTEWKQSPRYERTKNIDRKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences LRWTPGHEGIKGNELADTEAKKAAEGDTSAPNLLPQVLRRKSLPISTSALKQAYRTRIKRQWQTEWKQSPRYERTKNIDRKLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.19
5 0.15
6 0.17
7 0.17
8 0.16
9 0.16
10 0.14
11 0.12
12 0.12
13 0.13
14 0.13
15 0.15
16 0.14
17 0.14
18 0.13
19 0.11
20 0.11
21 0.1
22 0.1
23 0.19
24 0.21
25 0.23
26 0.23
27 0.26
28 0.27
29 0.3
30 0.28
31 0.21
32 0.23
33 0.23
34 0.24
35 0.24
36 0.24
37 0.21
38 0.23
39 0.25
40 0.3
41 0.38
42 0.41
43 0.47
44 0.54
45 0.63
46 0.7
47 0.71
48 0.73
49 0.74
50 0.78
51 0.79
52 0.81
53 0.79
54 0.78
55 0.75
56 0.74
57 0.73
58 0.74
59 0.72
60 0.71
61 0.73
62 0.76
63 0.81
64 0.79