Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UR08

Protein Details
Accession A0A165UR08   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-39LWKVPWRLSRTRKANQRDRLKKVDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 12, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSHPSLSGLLWKVPWRLSRTRKANQRDRLKKVDAVIEAVRSSGVQCAALTQALELPKEHEMAPKDKYTVFSPHSRNYRKGIHKVPKFTRITHRVNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.27
5 0.28
6 0.3
7 0.31
8 0.31
9 0.39
10 0.46
11 0.55
12 0.6
13 0.67
14 0.72
15 0.77
16 0.81
17 0.81
18 0.84
19 0.83
20 0.81
21 0.8
22 0.74
23 0.67
24 0.59
25 0.54
26 0.43
27 0.37
28 0.3
29 0.24
30 0.2
31 0.17
32 0.15
33 0.1
34 0.09
35 0.07
36 0.06
37 0.05
38 0.05
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.07
45 0.07
46 0.08
47 0.07
48 0.09
49 0.1
50 0.11
51 0.11
52 0.13
53 0.16
54 0.19
55 0.22
56 0.22
57 0.22
58 0.22
59 0.25
60 0.24
61 0.27
62 0.28
63 0.32
64 0.36
65 0.42
66 0.51
67 0.54
68 0.55
69 0.54
70 0.6
71 0.61
72 0.65
73 0.68
74 0.68
75 0.71
76 0.77
77 0.78
78 0.78
79 0.73
80 0.7
81 0.71
82 0.69
83 0.69
84 0.68
85 0.72