Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165P3E5

Protein Details
Accession A0A165P3E5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-116KQAYRTRLMKQWKKEWKQSPRYERTAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF00075  RNase_H  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
CDD cd09276  Rnase_HI_RT_non_LTR  
Amino Acid Sequences MAVLQALPTRKVRPGYHILQHIRNQAQRLIDRHKDLKIVLRWVPGHKDLEGNELADKEAKRAAKGKTSATHLLPQILRRKPLPLSVSALKQAYRTRLMKQWKKEWKQSPRYERTAAIDPKLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.52
4 0.58
5 0.58
6 0.58
7 0.61
8 0.61
9 0.59
10 0.55
11 0.5
12 0.44
13 0.45
14 0.43
15 0.43
16 0.43
17 0.43
18 0.46
19 0.47
20 0.45
21 0.42
22 0.38
23 0.41
24 0.37
25 0.36
26 0.33
27 0.34
28 0.34
29 0.35
30 0.38
31 0.33
32 0.3
33 0.25
34 0.26
35 0.21
36 0.23
37 0.21
38 0.18
39 0.15
40 0.13
41 0.13
42 0.13
43 0.13
44 0.1
45 0.13
46 0.12
47 0.13
48 0.18
49 0.2
50 0.23
51 0.25
52 0.28
53 0.28
54 0.33
55 0.35
56 0.32
57 0.34
58 0.28
59 0.29
60 0.27
61 0.29
62 0.32
63 0.32
64 0.32
65 0.29
66 0.32
67 0.3
68 0.35
69 0.32
70 0.27
71 0.3
72 0.31
73 0.32
74 0.32
75 0.32
76 0.26
77 0.27
78 0.28
79 0.27
80 0.31
81 0.31
82 0.32
83 0.39
84 0.49
85 0.54
86 0.59
87 0.65
88 0.69
89 0.75
90 0.81
91 0.83
92 0.83
93 0.86
94 0.88
95 0.88
96 0.86
97 0.85
98 0.78
99 0.72
100 0.66
101 0.66
102 0.6
103 0.52