Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165MS72

Protein Details
Accession A0A165MS72    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
172-199GIDEHGHKKRTRRSRRSRQSAARLTIPSHydrophilic
NLS Segment(s)
PositionSequence
178-189HKKRTRRSRRSR
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 4, pero 4
Family & Domain DBs
Amino Acid Sequences MSVKYGTRTRQLHAEVRTQKHVYDLAQSDLEHCDDSRRVYVVKELITEPKIDAWLEETPSADVCTRCHTEAVEKVGAAISRLHSCPRQSDTRIGPALSRAPPAGGCTIDISTEPLLLCADDVTSNNFYIDPSFGKGPLVEEVARLIDLQRDKITLLGRVGVLIMMLGGRDLGIDEHGHKKRTRRSRRSRQSAARLTIPSSDTTPKIRSPLASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.59
4 0.64
5 0.56
6 0.51
7 0.47
8 0.45
9 0.36
10 0.35
11 0.32
12 0.27
13 0.28
14 0.28
15 0.26
16 0.25
17 0.24
18 0.17
19 0.15
20 0.16
21 0.16
22 0.19
23 0.2
24 0.2
25 0.19
26 0.19
27 0.24
28 0.24
29 0.24
30 0.23
31 0.23
32 0.26
33 0.26
34 0.26
35 0.21
36 0.19
37 0.18
38 0.16
39 0.14
40 0.13
41 0.14
42 0.15
43 0.15
44 0.14
45 0.13
46 0.14
47 0.15
48 0.13
49 0.12
50 0.11
51 0.16
52 0.18
53 0.18
54 0.18
55 0.18
56 0.2
57 0.24
58 0.28
59 0.24
60 0.21
61 0.2
62 0.21
63 0.2
64 0.16
65 0.13
66 0.09
67 0.11
68 0.12
69 0.14
70 0.15
71 0.17
72 0.2
73 0.23
74 0.27
75 0.28
76 0.33
77 0.34
78 0.37
79 0.37
80 0.34
81 0.3
82 0.25
83 0.27
84 0.21
85 0.19
86 0.13
87 0.12
88 0.12
89 0.13
90 0.13
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.07
99 0.08
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.04
106 0.04
107 0.04
108 0.05
109 0.07
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.09
116 0.1
117 0.08
118 0.09
119 0.1
120 0.1
121 0.1
122 0.1
123 0.1
124 0.11
125 0.12
126 0.1
127 0.09
128 0.1
129 0.1
130 0.1
131 0.09
132 0.08
133 0.1
134 0.11
135 0.13
136 0.13
137 0.13
138 0.13
139 0.16
140 0.17
141 0.16
142 0.16
143 0.15
144 0.14
145 0.13
146 0.13
147 0.1
148 0.09
149 0.05
150 0.05
151 0.03
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.03
158 0.03
159 0.05
160 0.06
161 0.09
162 0.19
163 0.23
164 0.28
165 0.31
166 0.39
167 0.48
168 0.58
169 0.67
170 0.69
171 0.76
172 0.84
173 0.92
174 0.94
175 0.95
176 0.94
177 0.93
178 0.92
179 0.85
180 0.81
181 0.71
182 0.62
183 0.56
184 0.47
185 0.38
186 0.33
187 0.32
188 0.28
189 0.31
190 0.34
191 0.33
192 0.35
193 0.36