Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165N9B6

Protein Details
Accession A0A165N9B6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
108-127TGYNTQQPPKTPRKRGGNSVHydrophilic
NLS Segment(s)
PositionSequence
44-58KGKGRGGVEWKQRRR
Subcellular Location(s) cyto 16.5, cyto_nucl 10.5, mito 6, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MGGDGVLAVAGLSDWAKWREAAADAKHVLIAMQAAGPIVRVLGKGKGRGGVEWKQRRRIRSVASDSRHSTPVCRAITLSRHSLRSDTPEADLEYKQVLSRDPVGLALTGYNTQQPPKTPRKRGGNSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.11
5 0.11
6 0.13
7 0.16
8 0.23
9 0.22
10 0.27
11 0.27
12 0.27
13 0.26
14 0.24
15 0.2
16 0.14
17 0.12
18 0.05
19 0.05
20 0.05
21 0.05
22 0.04
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.06
29 0.12
30 0.14
31 0.16
32 0.18
33 0.21
34 0.22
35 0.22
36 0.27
37 0.28
38 0.36
39 0.44
40 0.48
41 0.54
42 0.57
43 0.58
44 0.58
45 0.56
46 0.52
47 0.51
48 0.55
49 0.53
50 0.53
51 0.55
52 0.52
53 0.49
54 0.46
55 0.37
56 0.3
57 0.25
58 0.29
59 0.25
60 0.23
61 0.21
62 0.21
63 0.27
64 0.28
65 0.32
66 0.27
67 0.28
68 0.28
69 0.29
70 0.27
71 0.29
72 0.3
73 0.24
74 0.23
75 0.23
76 0.24
77 0.25
78 0.24
79 0.18
80 0.15
81 0.15
82 0.14
83 0.13
84 0.12
85 0.13
86 0.16
87 0.16
88 0.15
89 0.15
90 0.15
91 0.15
92 0.14
93 0.11
94 0.1
95 0.1
96 0.1
97 0.13
98 0.14
99 0.17
100 0.19
101 0.26
102 0.33
103 0.43
104 0.53
105 0.59
106 0.67
107 0.75