Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165R2M1

Protein Details
Accession A0A165R2M1   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
166-197GSQVKRRIPKTPYPPRRRRRSCQSKTVEPGQEHydrophilic
214-239RLKTAFYKAIKKPRNKIVTKPAWRPWHydrophilic
NLS Segment(s)
PositionSequence
170-185KRRIPKTPYPPRRRRR
224-229KKPRNK
Subcellular Location(s) nucl 12, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MHFMLPTALLLSRGEVNCRHSWYPHRSTHCRFYPPKIGQMPPDERQALDDPFLDRAHRDVIESAPSSSLSPRARRRAMIEDADDDGESESEGHDSPAQFLGGIFLGMPPVSPTGSSQLQGVPAHLHGGTLSTPQRPTTRTTTIASPPTTPSAVYDNIFLETDAAIGSQVKRRIPKTPYPPRRRRRSCQSKTVEPGQEETSRAKVRYSLETIASRLKTAFYKAIKKPRNKIVTKPAWRPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.28
4 0.31
5 0.37
6 0.37
7 0.36
8 0.44
9 0.5
10 0.56
11 0.58
12 0.63
13 0.66
14 0.71
15 0.76
16 0.74
17 0.74
18 0.7
19 0.69
20 0.71
21 0.66
22 0.68
23 0.64
24 0.59
25 0.55
26 0.6
27 0.59
28 0.51
29 0.53
30 0.45
31 0.39
32 0.4
33 0.38
34 0.31
35 0.26
36 0.24
37 0.19
38 0.21
39 0.21
40 0.18
41 0.14
42 0.15
43 0.17
44 0.15
45 0.15
46 0.14
47 0.15
48 0.19
49 0.2
50 0.18
51 0.15
52 0.16
53 0.15
54 0.14
55 0.2
56 0.2
57 0.27
58 0.35
59 0.43
60 0.45
61 0.47
62 0.51
63 0.51
64 0.52
65 0.48
66 0.42
67 0.35
68 0.34
69 0.32
70 0.27
71 0.2
72 0.14
73 0.1
74 0.08
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.07
82 0.08
83 0.09
84 0.09
85 0.08
86 0.08
87 0.08
88 0.06
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.03
96 0.04
97 0.04
98 0.04
99 0.05
100 0.09
101 0.1
102 0.11
103 0.11
104 0.1
105 0.13
106 0.13
107 0.13
108 0.09
109 0.08
110 0.09
111 0.09
112 0.08
113 0.05
114 0.06
115 0.06
116 0.08
117 0.1
118 0.1
119 0.11
120 0.13
121 0.16
122 0.16
123 0.2
124 0.24
125 0.26
126 0.28
127 0.29
128 0.31
129 0.34
130 0.37
131 0.34
132 0.29
133 0.26
134 0.25
135 0.24
136 0.2
137 0.17
138 0.15
139 0.16
140 0.15
141 0.15
142 0.13
143 0.14
144 0.14
145 0.12
146 0.09
147 0.07
148 0.07
149 0.06
150 0.05
151 0.04
152 0.05
153 0.07
154 0.11
155 0.15
156 0.18
157 0.24
158 0.26
159 0.34
160 0.39
161 0.47
162 0.54
163 0.62
164 0.7
165 0.75
166 0.84
167 0.86
168 0.91
169 0.92
170 0.9
171 0.9
172 0.91
173 0.88
174 0.88
175 0.86
176 0.84
177 0.81
178 0.8
179 0.75
180 0.64
181 0.59
182 0.53
183 0.47
184 0.39
185 0.36
186 0.34
187 0.32
188 0.32
189 0.29
190 0.29
191 0.3
192 0.35
193 0.38
194 0.33
195 0.34
196 0.36
197 0.38
198 0.4
199 0.37
200 0.31
201 0.27
202 0.26
203 0.23
204 0.25
205 0.31
206 0.31
207 0.4
208 0.48
209 0.58
210 0.65
211 0.72
212 0.77
213 0.8
214 0.83
215 0.79
216 0.8
217 0.8
218 0.82
219 0.82