Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UHZ5

Protein Details
Accession A0A165UHZ5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-102CFPIDFRRKMRQKLKRCFQNDRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005162  Retrotrans_gag_dom  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences ILKPIPPTAYDGTPDTRQFVKFMTEAIAYVEDGRLSSERRMQYIAHYLSGRALDFYTRSVSMNPTEWELDQFFSELFNYCFPIDFRRKMRQKLKRCFQNDRSVREYVFELTELYNMIGVDGERDKVVKLWDGLNKDIQAELWRNKLNPETSSWEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.3
4 0.29
5 0.27
6 0.26
7 0.25
8 0.2
9 0.2
10 0.19
11 0.17
12 0.16
13 0.17
14 0.16
15 0.12
16 0.12
17 0.12
18 0.08
19 0.08
20 0.1
21 0.1
22 0.11
23 0.13
24 0.19
25 0.2
26 0.22
27 0.24
28 0.23
29 0.25
30 0.31
31 0.3
32 0.27
33 0.25
34 0.24
35 0.24
36 0.24
37 0.2
38 0.12
39 0.11
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.13
48 0.14
49 0.16
50 0.15
51 0.15
52 0.15
53 0.14
54 0.15
55 0.14
56 0.13
57 0.1
58 0.1
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.08
66 0.07
67 0.08
68 0.08
69 0.15
70 0.19
71 0.24
72 0.29
73 0.37
74 0.44
75 0.53
76 0.63
77 0.66
78 0.72
79 0.77
80 0.82
81 0.82
82 0.82
83 0.83
84 0.79
85 0.8
86 0.76
87 0.71
88 0.65
89 0.57
90 0.51
91 0.42
92 0.37
93 0.27
94 0.22
95 0.16
96 0.12
97 0.11
98 0.11
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.06
105 0.06
106 0.08
107 0.08
108 0.09
109 0.08
110 0.09
111 0.09
112 0.1
113 0.13
114 0.13
115 0.14
116 0.19
117 0.24
118 0.28
119 0.3
120 0.32
121 0.31
122 0.29
123 0.27
124 0.23
125 0.23
126 0.26
127 0.27
128 0.3
129 0.33
130 0.33
131 0.37
132 0.42
133 0.41
134 0.37
135 0.38
136 0.39