Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165SFG0

Protein Details
Accession A0A165SFG0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-68RDCGCPTLKRDNQKRQNMFRTKCPTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 13, cyto 7, mito 3, pero 2, vacu 2
Family & Domain DBs
Amino Acid Sequences YDRVADYYSGCQHWVNIYYTGDKTDCGSETCKTSQSHKHKTARDCGCPTLKRDNQKRQNMFRTKCPTCLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.2
4 0.21
5 0.22
6 0.22
7 0.24
8 0.21
9 0.18
10 0.16
11 0.15
12 0.15
13 0.13
14 0.15
15 0.14
16 0.17
17 0.18
18 0.21
19 0.21
20 0.25
21 0.33
22 0.4
23 0.48
24 0.54
25 0.6
26 0.62
27 0.66
28 0.71
29 0.68
30 0.66
31 0.6
32 0.56
33 0.56
34 0.53
35 0.52
36 0.53
37 0.52
38 0.54
39 0.61
40 0.68
41 0.7
42 0.78
43 0.83
44 0.82
45 0.87
46 0.87
47 0.82
48 0.81
49 0.81
50 0.73
51 0.69