Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ND34

Protein Details
Accession A0A165ND34    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-119AKEKERAKTKKEKSDGRPRKRARRLVEMSRIRBasic
NLS Segment(s)
PositionSequence
87-111EAKEKERAKTKKEKSDGRPRKRARR
Subcellular Location(s) mito 16, nucl 10, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKFAPHRKSYNNPTATSSTVCQKCLGTGHFTYQCKASARPYLSRPSRTQQLENPRALAKLKEAGKPSVEVPAELKSKTGTANRILEAKEKERAKTKKEKSDGRPRKRARRLVEMSRIRMCSSCLIVRLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.54
4 0.47
5 0.39
6 0.38
7 0.35
8 0.34
9 0.3
10 0.27
11 0.26
12 0.28
13 0.28
14 0.24
15 0.23
16 0.28
17 0.34
18 0.35
19 0.34
20 0.31
21 0.33
22 0.3
23 0.3
24 0.28
25 0.29
26 0.31
27 0.35
28 0.37
29 0.43
30 0.46
31 0.5
32 0.5
33 0.47
34 0.52
35 0.51
36 0.5
37 0.48
38 0.53
39 0.54
40 0.51
41 0.47
42 0.39
43 0.37
44 0.34
45 0.27
46 0.18
47 0.18
48 0.2
49 0.22
50 0.23
51 0.24
52 0.23
53 0.24
54 0.22
55 0.22
56 0.19
57 0.15
58 0.14
59 0.18
60 0.19
61 0.17
62 0.17
63 0.12
64 0.13
65 0.16
66 0.18
67 0.16
68 0.2
69 0.23
70 0.23
71 0.26
72 0.26
73 0.28
74 0.29
75 0.29
76 0.32
77 0.31
78 0.33
79 0.4
80 0.45
81 0.47
82 0.54
83 0.6
84 0.63
85 0.7
86 0.77
87 0.76
88 0.82
89 0.86
90 0.85
91 0.87
92 0.87
93 0.89
94 0.9
95 0.89
96 0.85
97 0.85
98 0.83
99 0.82
100 0.83
101 0.79
102 0.75
103 0.73
104 0.67
105 0.58
106 0.5
107 0.43
108 0.37
109 0.34
110 0.31
111 0.27