Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165Q7S6

Protein Details
Accession A0A165Q7S6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
204-226RKDPPRVATKAKRRKLEDRMQVTBasic
NLS Segment(s)
PositionSequence
208-218PRVATKAKRRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MHDTTTVPAFQKLPVELLYEIQSLALSESLPYTCKHFHMVFKAAPSSVRAHYLIQRYMSNQTTSTIAQGVVSKALRFPLCTQDVLQRMIESLDCPPLRLANPELPRRLFRSLAPAFSDKRGHRWTDHDEPLPFLRYMYSHPTIPAPNPDSHDGYALTKAVYAGFIPLVQFLLDHGASPACKNGLAAMIAIRHKDLPLLKMLVERKDPPRVATKAKRRKLEDRMQVTPEMLTLAVKGDARDIVQYLTEKGCIPDMQTLKLLARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.2
4 0.21
5 0.22
6 0.19
7 0.17
8 0.15
9 0.14
10 0.1
11 0.11
12 0.09
13 0.06
14 0.06
15 0.08
16 0.08
17 0.1
18 0.1
19 0.14
20 0.16
21 0.18
22 0.23
23 0.25
24 0.31
25 0.36
26 0.42
27 0.39
28 0.4
29 0.41
30 0.36
31 0.33
32 0.3
33 0.27
34 0.22
35 0.24
36 0.21
37 0.22
38 0.27
39 0.32
40 0.33
41 0.31
42 0.31
43 0.3
44 0.34
45 0.34
46 0.3
47 0.24
48 0.22
49 0.22
50 0.21
51 0.2
52 0.15
53 0.12
54 0.12
55 0.13
56 0.12
57 0.13
58 0.14
59 0.13
60 0.12
61 0.16
62 0.15
63 0.16
64 0.18
65 0.22
66 0.23
67 0.24
68 0.25
69 0.28
70 0.3
71 0.3
72 0.28
73 0.2
74 0.18
75 0.18
76 0.17
77 0.11
78 0.09
79 0.14
80 0.14
81 0.15
82 0.15
83 0.16
84 0.16
85 0.18
86 0.2
87 0.21
88 0.27
89 0.32
90 0.35
91 0.35
92 0.36
93 0.38
94 0.37
95 0.31
96 0.25
97 0.3
98 0.28
99 0.28
100 0.29
101 0.28
102 0.26
103 0.28
104 0.34
105 0.24
106 0.3
107 0.32
108 0.31
109 0.3
110 0.34
111 0.38
112 0.4
113 0.43
114 0.39
115 0.36
116 0.36
117 0.35
118 0.32
119 0.24
120 0.17
121 0.13
122 0.1
123 0.13
124 0.17
125 0.17
126 0.15
127 0.16
128 0.18
129 0.19
130 0.19
131 0.22
132 0.19
133 0.19
134 0.22
135 0.24
136 0.24
137 0.23
138 0.24
139 0.19
140 0.17
141 0.16
142 0.14
143 0.11
144 0.08
145 0.08
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.07
159 0.07
160 0.07
161 0.07
162 0.08
163 0.08
164 0.09
165 0.1
166 0.07
167 0.07
168 0.07
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.11
175 0.12
176 0.13
177 0.13
178 0.12
179 0.12
180 0.15
181 0.16
182 0.14
183 0.17
184 0.18
185 0.18
186 0.23
187 0.27
188 0.27
189 0.29
190 0.33
191 0.34
192 0.42
193 0.42
194 0.39
195 0.45
196 0.45
197 0.51
198 0.56
199 0.62
200 0.65
201 0.71
202 0.77
203 0.76
204 0.81
205 0.81
206 0.81
207 0.8
208 0.77
209 0.75
210 0.7
211 0.64
212 0.55
213 0.44
214 0.34
215 0.25
216 0.17
217 0.11
218 0.08
219 0.08
220 0.1
221 0.1
222 0.1
223 0.11
224 0.12
225 0.13
226 0.14
227 0.14
228 0.12
229 0.14
230 0.16
231 0.17
232 0.17
233 0.18
234 0.17
235 0.17
236 0.2
237 0.18
238 0.19
239 0.25
240 0.26
241 0.27
242 0.28
243 0.29